Recombinant Methanoregula boonei UPF0059 membrane protein Mboo_0607 (Mboo_0607)

What is Recombinant Methanoregula boonei UPF0059 membrane protein Mboo_0607 and what is its function?

Recombinant Methanoregula boonei UPF0059 membrane protein Mboo_0607 (also known as mntP) is a full-length (185 amino acid) membrane protein that functions as a putative manganese efflux pump . This protein belongs to the UPF0059 membrane protein family and has been characterized with the UniProt ID A7I5W4 . Structurally, it contains transmembrane domains typical of transport proteins, with the recombinant version being expressed in E. coli with an N-terminal His-tag for purification purposes .

The protein likely plays a critical role in manganese homeostasis within Methanoregula boonei, an archaeal species adapted to low-sodium, high-proton environments like peat bogs . Based on genomic and functional analyses, this protein helps facilitate the organism's survival by contributing to metal ion transportation across membranes, specifically using H⁺ rather than Na⁺ transmembrane chemiosmotic gradients, which is a key adaptation to its peat-dwelling lifestyle .

How does the amino acid sequence of Mboo_0607 compare to homologous proteins in other methanogens?

The Mboo_0607 protein sequence (MDLLTSSLIGIGLSMDCFAVALAIGTSERLPLVRSALVIAASFGIFQAGMTIAGWIAGAS LYTEISSYGSWIAFLLLAGIGIKMIYDGIREEHEPTLSGLHAIPVILLSLATSIDAFAAG VSFGVLGSTVLMPALAIGLVCFVVSCAGVFCGMRLEKLLGNRTEIFGGVILILIGIQILT DILPL) shows significant structural similarities with other UPF0059 family membrane proteins, particularly those found in other methanogenic archaea .

When compared to the homologous Methanosarcina mazei UPF0059 membrane protein MM_0643 (sequence: MSFLTNFLLGLGLAMDAFAVSMSSGTTVRPFKVSDALKLAVFFGGFQALMPVLGWVGGSA VSGFVSDYAPWIAFGLLAFIGGKMIYEALYGDPDGKVNSLNYSMLFLLAVATSIDALAVG ISFAFLGTPILEPVIIIGCVTFVMSFCGAVLGYRIGHFFENEVEILGGLILIGLGVKILA EHMDWI), several conserved domains become apparent . Both proteins share:

The high conservation of hydrophobic and transmembrane domains suggests functional conservation despite evolutionary divergence, while the differences in terminal regions may reflect species-specific adaptations related to their distinct ecological niches .

What experimental expression systems are optimal for producing functional Mboo_0607 protein?

For optimal expression of functional Mboo_0607 protein, E. coli-based expression systems have proven effective for producing the recombinant protein with an N-terminal His-tag . The effectiveness of this approach is evidenced by the commercially available protein with greater than 90% purity as determined by SDS-PAGE .

When designing expression systems, researchers should consider the following methodological parameters:

• Vector selection: Vectors containing strong inducible promoters (such as T7) are recommended for membrane protein expression

• E. coli strain optimization: BL21(DE3) or C41(DE3) strains often show improved membrane protein expression

• Induction conditions: Lower temperatures (16-25°C) and reduced inducer concentrations can improve the yield of properly folded membrane proteins

• Solubilization optimization: Careful selection of detergents for extraction from the membrane is critical

For researchers requiring higher yields or alternative folding patterns, yeast-based systems or cell-free expression systems could be explored as alternatives, though these approaches would require protocol optimization beyond the established E. coli methodology documented for Mboo_0607 .

How should researchers design experiments to analyze the ion transport function of Mboo_0607?

When designing experiments to analyze the ion transport function of Mboo_0607, researchers should implement a multi-faceted approach focused on both in vitro and in vivo functional assays. Based on its putative function as a manganese efflux pump, the following methodological framework is recommended:

In vitro transport assays:

• Proteoliposome-based transport studies: Reconstitute purified Mboo_0607 into liposomes with various internal/external ion gradients

• Fluorescence-based assays: Utilize fluorescent metal indicators to detect manganese transport across membranes

• Isotope-based flux assays: Use radiolabeled manganese (⁵⁴Mn) to directly measure transport rates

In vivo functional characterization:

• Complementation studies: Express Mboo_0607 in manganese transport-deficient bacterial or yeast strains

• Growth inhibition assays: Test whether Mboo_0607 expression confers resistance to high manganese concentrations

• Metal accumulation assays: Measure intracellular manganese levels in cells expressing Mboo_0607 versus controls

When conducting these experiments, it's crucial to account for Methanoregula boonei's native adaptation to H⁺-dependent (rather than Na⁺-dependent) chemiosmotic gradients . Therefore, experimental conditions should include pH gradients that mimic the acidic peat bog environments where this organism naturally occurs.

What statistical approaches are most appropriate for analyzing Mboo_0607 transport kinetics data?

When analyzing Mboo_0607 transport kinetics data, researchers should implement rigorous statistical frameworks that account for the complex nature of membrane protein function. Based on established methodologies in transport kinetics, the following statistical approaches are recommended:

• Michaelis-Menten kinetics analysis: For determining $K_m$ and $V_{max}$ parameters of manganese transport

  • Use non-linear regression rather than linear transformations (e.g., Lineweaver-Burk plots) for more accurate parameter estimation

  • Apply weighted least squares methods to account for heteroscedasticity in transport data

• Comparison of experimental conditions: When comparing transport rates under different conditions (pH, ion concentrations, etc.)

  • Use ANOVA with appropriate post-hoc tests for multiple comparisons

  • Consider repeated measures designs when using the same protein preparation across conditions

• Analysis of variability: To ensure robust and reproducible findings

  • Calculate and report measures of central tendency (mean) and variability (standard deviation)

  • Implement power analyses to determine appropriate sample sizes for detecting physiologically relevant effects

How can site-directed mutagenesis be used to identify critical residues in Mboo_0607 function?

Site-directed mutagenesis represents a powerful approach for identifying critical functional residues in Mboo_0607. Based on the protein's sequence and predicted membrane topology, the following methodological framework is recommended:

• Target selection strategy:

  • Conserved residues identified through alignment with homologous proteins (e.g., MM_0643)

  • Charged residues within predicted transmembrane domains that might form part of the transport pathway

  • Residues that differ between Mboo_0607 and homologs from non-peat environments, which might contribute to H⁺ preference over Na⁺

• Mutation design considerations:

  • Conservative substitutions (maintaining similar physicochemical properties) to test residue importance

  • Charge-reversing mutations for analyzing electrostatic interactions

  • Cysteine substitutions for subsequent accessibility studies using sulfhydryl reagents

• Functional analysis of mutants:

  • Transport assays comparing wild-type and mutant proteins

  • Protein stability and membrane integration verification

  • Binding assays to determine if defects are in substrate recognition or translocation

A systematic mutational analysis should focus particularly on the regions predicted to form the manganese binding site and the ion translocation pathway. Based on other characterized metal transporters, histidine, aspartate, and glutamate residues often participate in metal coordination and represent high-priority targets for initial mutagenesis experiments.

How can Mboo_0607 be incorporated into bioenergetic studies of archaea adapted to low-sodium environments?

Incorporating Mboo_0607 into bioenergetic studies of archaea adapted to low-sodium environments requires a sophisticated experimental approach that capitalizes on this protein's role in Methanoregula boonei's unique adaptation to peat environments. Researchers should consider the following methodological framework:

• Comparative bioenergetic analysis:

  • Reconstitute purified Mboo_0607 in proteoliposomes with defined H⁺ and Na⁺ gradients

  • Compare ATP synthesis or ion flux rates under varying Na⁺/H⁺ ratios

  • Quantify the energetic efficiency of Mboo_0607-mediated transport compared to Na⁺-dependent homologs

• Integration with archaeal energy conservation systems:

  • Examine potential interactions between Mboo_0607 and membrane-bound hydrogenases (Ech, Eha, Mbh)

  • Investigate if Mboo_0607 functions within a larger ion transport network that contributes to energy conservation

  • Map the role of Mboo_0607 in relation to other H⁺-utilizing systems in Methanoregula boonei

• Environmental adaptation studies:

  • Test Mboo_0607 function under conditions mimicking peat bog environments (low pH, low Na⁺)

  • Determine how Mboo_0607 contributes to cellular bioenergetics under stress conditions

  • Compare performance with homologs from non-peat dwelling methanogens

This approach would yield valuable insights into how Methanoregula boonei has evolved specialized membrane proteins to thrive in environments where conventional Na⁺-based bioenergetics would be challenging, representing a fundamental adaptation in archaeal bioenergetics .

What structural biology approaches are most suitable for determining the three-dimensional structure of Mboo_0607?

Determining the three-dimensional structure of Mboo_0607 presents significant challenges typical of membrane proteins. Based on current structural biology methodologies, the following approaches are recommended:

• X-ray crystallography:

  • Optimize detergent selection for crystal formation (screen detergents like DDM, LMNG, and UDM)

  • Consider lipidic cubic phase (LCP) crystallization which often yields better diffracting crystals for membrane proteins

  • Implement surface engineering approaches such as fusion proteins (e.g., BRIL, T4 lysozyme) to increase polar surface area

• Cryo-electron microscopy (cryo-EM):

  • Consider reconstitution in nanodiscs or amphipols to maintain native-like lipid environment

  • Implement recent advances in single-particle analysis for small membrane proteins

  • Use computational approaches to overcome preferential orientation issues common with membrane proteins

• Integrative structural biology:

  • Combine lower-resolution structural data with computational modeling

  • Implement hydrogen-deuterium exchange mass spectrometry to map solvent-accessible regions

  • Use cross-linking mass spectrometry to identify spatial constraints

• NMR spectroscopy:

  • Consider solid-state NMR approaches for membrane-embedded protein

  • Implement selective isotopic labeling to resolve crowded spectra

  • Use fragment-based approaches if the full protein proves challenging

The most effective strategy likely involves an integrative approach combining multiple techniques, potentially starting with homology modeling based on structures of related proteins like MM_0643 , followed by experimental validation and refinement.

How can systems biology approaches be used to understand the role of Mboo_0607 in manganese homeostasis networks?

Understanding the role of Mboo_0607 in manganese homeostasis networks requires sophisticated systems biology approaches that integrate multiple levels of biological information. The following methodological framework is recommended:

• Transcriptomic analysis:

  • Profile gene expression changes in response to varying manganese concentrations

  • Identify co-regulated genes that might function in the same manganese homeostasis network

  • Compare transcriptional responses between wild-type and Mboo_0607 knockout/knockdown strains

• Interactome mapping:

  • Implement affinity purification-mass spectrometry to identify protein interaction partners

  • Use bacterial two-hybrid or split-GFP systems adapted for membrane proteins

  • Create protein-protein interaction networks centered on Mboo_0607

• Metabolomic integration:

  • Profile metabolic changes associated with manganese availability

  • Link Mboo_0607 activity to broader cellular metabolism

  • Identify metabolic pathways dependent on proper manganese homeostasis

• Mathematical modeling:

  • Develop kinetic models of manganese transport and homeostasis

  • Integrate experimental data into predictive models

  • Simulate system behavior under various environmental conditions

This systems-level approach would position Mboo_0607 within the broader context of cellular function, revealing not only its direct role in manganese transport but also its indirect effects on cellular metabolism, stress responses, and adaptation to the unique ecological niche of peat environments .

What are the common challenges in purifying Mboo_0607 and how can they be addressed?

Purification of membrane proteins like Mboo_0607 presents several technical challenges. Based on established protocols and the specific characteristics of this protein, researchers should consider the following methodological solutions:

• Protein solubilization challenges:

  • Issue: Insufficient extraction from membranes

  • Solution: Systematic detergent screening (start with DDM, LMNG, or UDM at 1-2% concentrations)

  • Method: Implement a small-scale solubilization screen monitoring extraction efficiency by Western blot

• Protein instability during purification:

  • Issue: Aggregation or precipitation during purification steps

  • Solution: Include stabilizing additives (glycerol 10-20%, cholesteryl hemisuccinate, specific lipids)

  • Method: Monitor protein stability using size-exclusion chromatography profiles

• His-tag accessibility limitations:

  • Issue: Reduced binding to Ni-NTA resin

  • Solution: Consider extended wash steps with low imidazole (10-20 mM) followed by elution with 250-500 mM imidazole

  • Method: Optimize binding conditions using different buffer compositions and detergent concentrations

• Low yield challenges:

  • Issue: Insufficient final purified protein quantity

  • Solution: Scale-up expression, optimize induction conditions (try lower temperatures like 18°C)

  • Method: Implement the recommended reconstitution protocol in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage

For researchers experiencing persistent purification difficulties, the addition of specific lipids from the native Methanoregula boonei membrane environment might improve protein stability, as these archaea often possess unique membrane compositions that contribute to protein function in low-sodium, high-proton environments .

How can researchers verify that recombinant Mboo_0607 is correctly folded and functional?

Verifying the correct folding and functionality of recombinant Mboo_0607 is critical for ensuring experimental reliability. The following methodological approaches are recommended:

• Structural integrity assessment:

  • Circular dichroism (CD) spectroscopy: To verify secondary structure content

  • Fluorescence spectroscopy: To analyze tertiary structure integrity using intrinsic tryptophan fluorescence

  • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS): To confirm monodispersity and appropriate oligomeric state

• Functional validation:

  • Manganese binding assays: Using isothermal titration calorimetry or fluorescence-based metal sensors

  • Transport assays: In proteoliposomes with defined ion gradients

  • Complementation studies: In manganese transport-deficient bacterial strains

• Thermal stability analysis:

  • Differential scanning fluorimetry: To determine melting temperature and stability

  • Thermal shift assays: To identify stabilizing buffer conditions or ligands

  • Limited proteolysis: To assess compact folding versus disordered regions

• Comparative analysis with native protein:

  • Compare properties with protein extracted directly from Methanoregula boonei if possible

  • Verify that recombinant protein exhibits expected responses to environmental conditions (pH, ion concentrations)

Researchers should be particularly attentive to the impact of detergents and buffer conditions on protein stability, as improper selection can lead to partial unfolding or aggregation that might not be immediately apparent without these validation steps .

What are effective strategies for optimizing the storage and handling of purified Mboo_0607 protein?

Optimizing storage and handling of purified Mboo_0607 protein is critical for maintaining its structural integrity and functional activity. Based on established protocols for membrane proteins and specific recommendations for this protein, the following methodological guidelines are recommended:

• Short-term storage (1-7 days):

  • Store at 4°C in appropriate buffer system with detergent above its critical micelle concentration

  • Avoid repeated freeze-thaw cycles which can damage membrane proteins

  • Working aliquots can be maintained at 4°C for up to one week

• Long-term storage:

  • Store at -20°C or preferably -80°C in small aliquots

  • Add cryoprotectants: 6% trehalose and 50% glycerol (final concentration) is recommended for this specific protein

  • Store in Tris/PBS-based buffer at pH 8.0 as specifically optimized for Mboo_0607

• Reconstitution protocol:

  • Briefly centrifuge vials prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration before aliquoting for storage

• Handling considerations:

  • Minimize exposure to room temperature during experiments

  • Avoid vigorous vortexing which can denature membrane proteins (gentle mixing only)

  • Use low-binding microcentrifuge tubes to prevent protein loss through adsorption

Following these optimized protocols will minimize protein degradation and activity loss, ensuring reliable experimental results across multiple studies and extending the useful lifetime of valuable protein preparations .

How can comparative analysis of Mboo_0607 and homologous proteins inform our understanding of archaeal adaptation to extreme environments?

Comparative analysis of Mboo_0607 and its homologs offers valuable insights into archaeal adaptation mechanisms to extreme environments. The following research framework is recommended:

This comparative approach would contribute significantly to our understanding of how membrane proteins evolve in response to environmental constraints, particularly highlighting Methanoregula boonei's adaptation to the low Na⁺/high H⁺ challenges of peat environments through modified ion transport mechanisms .

What experimental designs can test the hypothesis that Mboo_0607 contributes to acid tolerance in Methanoregula boonei?

Testing the hypothesis that Mboo_0607 contributes to acid tolerance in Methanoregula boonei requires a multi-faceted experimental approach. The following methodological framework is recommended:

• Gene knockout/knockdown studies:

  • Generate Mboo_0607 deletion or knockdown strains in Methanoregula boonei

  • Compare growth rates and survival of wild-type vs. mutant strains under varying pH conditions

  • Measure intracellular pH homeostasis in both strains during acid challenges

• Heterologous expression studies:

  • Express Mboo_0607 in acid-sensitive archaea or bacteria

  • Assess whether expression confers improved growth or survival at low pH

  • Measure changes in intracellular manganese levels and pH homeostasis

• Biochemical characterization:

  • Compare transport activity of purified Mboo_0607 reconstituted in liposomes across pH gradients

  • Determine if transport activity correlates with the physiological pH range of peat environments

  • Analyze whether manganese transport is coupled to H⁺ movement across membranes

• Transcriptional regulation analysis:

  • Examine expression levels of Mboo_0607 under different pH conditions

  • Identify potential acid-responsive regulatory elements in the promoter region

  • Map the integration of Mboo_0607 in the broader acid stress response network

This comprehensive approach would establish whether Mboo_0607's function as a putative manganese efflux pump directly contributes to acid tolerance, potentially by removing excess manganese that might become more soluble and potentially toxic under acidic conditions .

How might Mboo_0607 research contribute to our understanding of horizontal gene transfer in archaea?

Research on Mboo_0607 can provide valuable insights into horizontal gene transfer (HGT) processes in archaea. The following methodological framework is recommended for investigating this aspect:

• Comparative genomic analysis for HGT detection:

  • Implement methods like normalized lineage probability index analysis to detect potential HGT events

  • Apply SIGI-HMM analysis to detect HGT based on codon usage bias

  • Use IslandPath-DIMOB to detect HGT related to the co-occurrence of abnormal dinucleotide frequencies

• Synteny analysis of genomic neighborhoods:

  • Analyze the genomic context of Mboo_0607 and compare it with homologs in other archaea

  • Identify conserved gene clusters or operonic structures that might have been transferred together

  • Examine proximity to mobile genetic elements that might facilitate HGT

• Functional adaptation analysis:

  • Investigate whether Mboo_0607 shows signatures of adaptation after HGT events

  • Compare function between Mboo_0607 and potential donor lineage homologs

  • Assess whether acquisition correlates with expansion into new ecological niches

• Integration with archaeal membrane biology:

  • Examine how potentially horizontally acquired transport systems integrate with existing membrane systems

  • Study interactions between Mboo_0607 and membrane-bound hydrogenases like Ech, which is present in all Methanoregula strains (core)

This research direction would contribute to our understanding of how HGT events shape archaeal adaptation to specific ecological niches, particularly in challenging environments like peat bogs where specialized transport systems like Mboo_0607 may provide selective advantages .