Recombinant Methanoregula boonei UPF0290 protein Mboo_0842 (Mboo_0842)

Shipped with Ice Packs
In Stock

Description

Characteristics of Recombinant Methanoregula boonei UPF0290 Protein Mboo_0842

  • Species: Methanoregula boonei (strain 6A8)

  • Uniprot Number: A7I6J9

  • Tag Info: The tag type is determined during the production process.

  • Storage Buffer: Tris-based buffer with 50% glycerol.

  • Storage Conditions: Store at -20°C for short-term and -80°C for long-term storage. Avoid repeated freezing and thawing.

  • Working Aliquots: Store at 4°C for up to one week.

  • Amino Acid Sequence: MVPAYIPNPVAALCGGGTPIDFCRNYTDGRRILGNGKTYRGLICGVLAGVLIGLVQIWLV GTYHWDLPRQTILSVTLLALGALLGDMGKSFIKRRLGKERGEAWPVADQYDLVVGAFLLT IIFDPAWFFAVVTLPVLIAILVITPVLHRSVNILGYWIKVKKEPW .

Table 1: Characteristics of Recombinant Methanoregula boonei UPF0290 Protein Mboo_0842

CharacteristicDescription
SpeciesMethanoregula boonei (strain 6A8)
Uniprot NumberA7I6J9
Tag InfoDetermined during production
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C or -80°C
Amino Acid SequenceProvided in section 2

Table 2: Potential Applications and Research Directions

Application/DirectionDescription
BiotechnologyPotential use in methanogenesis studies or as a molecular tool
Microbiological ResearchStudy of archaeal metabolism and survival mechanisms
ELISA AssaysUse in immunoassays for detection or quantification

References PubMed: Methanoregula boonei gen. nov., sp. nov., an acidiphilic, hydrogenotrophic methanogen isolated from an acidic bog in upstate New York. Colorectal Research: ELISA Recombinant Methanoregula boonei UPF0290 protein Mboo_0842 (Mboo_0842). Creative BioMart: CARS - cysteinyl-tRNA synthetase (Note: Not directly related to Mboo_0842 but provides context on protein functions and applications). NCBI Taxonomy Browser: Methanoregula.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution. Store at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type preference, please communicate it to us. We will prioritize developing the specified tag whenever possible.
Synonyms
carS; Mboo_0842; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8)
Target Names
carS
Target Protein Sequence
MVPAYIPNPVAALCGGGTPIDFCRNYTDGRRILGNGKTYRGLICGVLAGVLIGLVQIWLV GTYHWDLPRQTILSVTLLALGALLGDMGKSFIKRRLGKERGEAWPVADQYDLVVGAFLLT IIFDPAWFFAVVTLPVLIAILVITPVLHRSVNILGYWIKVKKEPW
Uniprot No.

Target Background

Function
This enzyme catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction constitutes the third ether-bond-formation step in the biosynthesis of archaeal membrane lipids.
Database Links
Protein Families
CDP-archaeol synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanoregula boonei and where was it originally isolated?

Methanoregula boonei is a methane-producing archaeon originally isolated from an acidic, ombrotrophic peat bog (McLean bog) near Ithaca, New York, United States. It was first sampled in August 2003 and is classified as strain 6A8 (DSM 21154, JCM 14090). The organism is categorized as a type strain within the order Methanomicrobiales . M. boonei is part of the archaeal domain, specifically within the Methanobacteriati phylum, Stenosarchaea group, and Methanomicrobia class .

The organism requires specific anaerobic cultivation conditions, with optimal growth occurring at 28°C in Medium 1280. An important characteristic to note is that growth typically occurs without visible increase in turbidity, necessitating phase contrast microscopy to verify cell proliferation. The standard incubation period exceeds 14 days, reflecting its slow growth rate common to many methanogenic archaea .

How is Methanoregula boonei taxonomically classified and what related species exist?

Methanoregula boonei belongs to the following taxonomic lineage:

  • Domain: Archaea

  • Phylum: Methanobacteriati

  • Class: Methanomicrobia

  • Order: Methanomicrobiales

  • Family: Methanoregulaceae

  • Genus: Methanoregula

  • Species: boonei

The closest related species is Methanoregula formicica, which shares 96.3% 16S rRNA gene sequence similarity and 85.4% deduced McrA amino acid sequence similarity with M. boonei. While these percentages indicate they are different species within the same genus, they share several phenotypic properties, including similar cell morphology and growth temperature ranges .

M. formicica strain SMSPT was isolated from an anaerobic, propionate-degrading enrichment culture originally obtained from granular sludge in a mesophilic upflow anaerobic sludge blanket reactor used to treat beer brewery effluent. Unlike M. boonei, which is found in acidic peat bogs, M. formicica has adapted to different environmental conditions while maintaining core methanogenic metabolic pathways .

What are the optimal expression and purification conditions for recombinant Mboo_0842?

Based on available research data, the optimal expression and purification protocol for recombinant Mboo_0842 involves the following methodological approaches:

Expression System:
E. coli is the preferred heterologous expression system for this archaeal protein . When designing expression constructs, researchers should consider:

  • Codon optimization for E. coli to address potential rare codon usage in archaeal genes

  • Including a fusion tag (determined during manufacturing process) to facilitate purification

  • Using inducible promoter systems (such as T7 or tac) to control expression levels

Purification Strategy:
The recombinant protein can be purified to >85% homogeneity using SDS-PAGE analysis . The typical workflow includes:

  • Cell lysis: Sonication or pressure-based disruption in an appropriate buffer system

  • Initial capture: Affinity chromatography based on the fusion tag

  • Polishing step: Size exclusion or ion exchange chromatography

  • Quality control: SDS-PAGE and potentially mass spectrometry verification

Storage Conditions:
For optimal stability, the purified protein should be stored in a Tris-based buffer with 50% glycerol . Storage recommendations include:

  • Short-term (up to one week): 4°C

  • Long-term: -20°C or -80°C in aliquots to avoid repeated freeze-thaw cycles

  • Reconstitution concentration: 0.1-1.0 mg/mL in deionized sterile water with 5-50% glycerol

The shelf life varies based on storage conditions: approximately 6 months for liquid formulations and 12 months for lyophilized preparations when stored at -20°C/-80°C .

How can the function of UPF0290 protein Mboo_0842 be experimentally determined?

Determining the function of UPF0290 protein Mboo_0842 requires a multi-faceted experimental approach. The "UPF" designation (Uncharacterized Protein Family) indicates that its function remains largely unknown. Based on current research methodologies, the following experimental strategies are recommended:

Computational Analysis:

  • Conduct comparative sequence analysis with proteins of known function across diverse organisms

  • Employ structural prediction tools to identify potential functional domains

  • Use gene neighborhood analysis to identify conserved genomic context that might suggest function

  • Analyze protein-protein interaction networks through database mining

In vitro Functional Assays:

  • Binding assays with potential substrates or interacting partners

  • Enzymatic activity screens based on predicted functional domains

  • Structural studies including X-ray crystallography or cryo-EM to determine three-dimensional structure

In vivo Approaches:

  • Gene knockout/knockdown studies in M. boonei (if genetic systems are available)

  • Heterologous expression in model organisms with phenotypic analysis

  • Transcriptomic analysis to identify co-expressed genes under various conditions

  • Localization studies using fluorescent protein fusions or immunolocalization

Specific Hypotheses to Test:
Based on sequence characteristics and the "carS" alternative name , this protein may be involved in:

  • Membrane transport functions

  • Signal transduction

  • Methanogenesis pathway regulation

  • Adaptation to acidic environments

A systematic approach combining these methods would provide the most comprehensive understanding of Mboo_0842's biological function.

What are the challenges in cultivating Methanoregula boonei for protein expression studies?

Cultivating Methanoregula boonei presents several significant challenges for researchers interested in protein expression studies:

Specific Growth Requirements:
M. boonei requires highly specialized conditions, including:

  • Strict anaerobic environment (oxygen-free)

  • Medium 1280 for optimal growth

  • Narrow temperature range (10-40°C, optimal at 28°C)

  • Extended incubation periods exceeding 14 days

Detection of Growth:
Unlike many model organisms, M. boonei growth does not produce visible turbidity in liquid culture, requiring:

  • Phase contrast microscopy to verify cell proliferation

  • Alternative growth monitoring techniques (e.g., methane production measurement)

Metabolic Constraints:
As a methanogenic archaeon, M. boonei has specific metabolic requirements:

  • Limited substrate utilization (primarily formate and hydrogen for growth and methane production)

  • Specific pH requirements (likely near neutral based on related species M. formicica preferring pH 7.0-7.6)

Technical Solutions:
To overcome these challenges, researchers commonly employ these strategies:

  • Use specialized anaerobic chambers and gas delivery systems

  • Implement real-time methane detection as a proxy for growth

  • Develop defined media formulations with potential growth enhancers

  • Establish co-culture systems that provide growth factors or remove inhibitory compounds

For protein expression studies specifically, heterologous expression in E. coli is generally more practical than native expression, as demonstrated by the commercial availability of recombinant Mboo_0842 produced in E. coli systems .

How can recombinant Mboo_0842 be used in structural and functional studies?

Recombinant Mboo_0842 can be utilized in various structural and functional studies to elucidate its biological role. Here are methodological approaches for different research objectives:

Structural Studies:

  • X-ray Crystallography:

    • Purify protein to >95% homogeneity

    • Screen various crystallization conditions (pH, temperature, precipitants)

    • Optimize crystal formation for high-resolution diffraction

    • Solve structure using molecular replacement or experimental phasing methods

  • NMR Spectroscopy (for specific domains):

    • Produce isotopically labeled protein (15N, 13C)

    • Perform multidimensional NMR experiments

    • Determine solution structure of soluble domains

  • Cryo-EM Analysis:

    • Particularly useful if the protein forms larger complexes

    • Prepare vitrified samples on specialized grids

    • Collect and process image data to generate 3D reconstructions

Functional Studies:

  • Protein-Protein Interaction Analysis:

    • Pull-down assays using tagged recombinant protein

    • Yeast two-hybrid or bacterial two-hybrid screening

    • Surface plasmon resonance to determine binding kinetics

    • Crosslinking studies followed by mass spectrometry

  • Enzymatic Activity Assessment:

    • Design activity assays based on:

      • Sequence homology to known enzymes

      • Structural predictions

      • Genomic context

    • Test various potential substrates

    • Determine optimal reaction conditions (pH, temperature, cofactors)

Experimental Design Considerations:

  • Use appropriate controls, including:

    • Heat-denatured protein

    • Tagged protein without the Mboo_0842 sequence

    • Related proteins from different organisms

  • Ensure experimental conditions account for the original environmental context of M. boonei (acidic, anaerobic)

  • Consider the potential membrane association of this protein when designing solubilization and purification strategies

What techniques are recommended for analyzing protein-protein interactions involving Mboo_0842?

Analysis of protein-protein interactions (PPIs) involving Mboo_0842 requires a comprehensive approach using complementary techniques. Below is a methodological framework for identifying and characterizing potential interaction partners:

In vitro Interaction Analysis:

  • Affinity Purification Coupled with Mass Spectrometry (AP-MS):

    • Express recombinant Mboo_0842 with an affinity tag

    • Perform pull-down experiments using M. boonei lysate or recombinant proteins

    • Identify binding partners through mass spectrometry

    • Validate specific interactions with targeted approaches

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI):

    • Immobilize purified Mboo_0842 on sensor chips/tips

    • Measure real-time binding kinetics with potential partners

    • Determine association/dissociation constants (ka, kd, KD)

    • Assess binding under varying conditions (pH, salt, temperature)

Structural Analysis of Complexes:

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Map interaction interfaces through differential deuterium uptake

    • Identify conformational changes upon binding

    • Provide structural insights without requiring crystallization

  • Cross-linking Mass Spectrometry (XL-MS):

    • Use chemical cross-linkers to capture transient interactions

    • Identify cross-linked peptides through specialized MS workflows

    • Generate distance constraints for modeling interaction interfaces

In vivo Interaction Analysis:

  • Bacterial Two-Hybrid System:

    • Particularly suitable for archaeal proteins

    • Create fusion constructs with split reporter proteins

    • Screen for interactions through reporter activation

    • Quantify interaction strength through reporter expression levels

TechniqueAdvantagesLimitationsBest Application Scenario
AP-MSIdentifies multiple interactions simultaneouslyRequires tag; may lose weak interactionsInitial screening for interaction partners
SPR/BLIProvides quantitative binding kineticsRequires purified proteinsDetailed characterization of specific interactions
HDX-MSMaps interaction interfaces; no crystallization neededComplex data analysisStructural characterization of complexes
XL-MSCaptures transient interactionsChemical modification may alter bindingIdentifying distant interaction sites
Bacterial Two-HybridDetects interactions in cell-like environmentPotential false positives/negativesValidation of specific interaction pairs

When designing these experiments, researchers should consider the membrane association prediction for Mboo_0842, which suggests potential interactions with other membrane proteins or lipids that may require specialized solubilization conditions.

How does the genomic context of Mboo_0842 inform potential functional studies?

Genomic context analysis provides valuable insights for designing functional studies of Mboo_0842. This approach examines neighboring genes, conserved gene clusters, and genomic organization to infer potential functional relationships.

Methodology for Genomic Context Analysis:

  • Gene Neighborhood Mapping:

    • Identify genes flanking Mboo_0842 in the M. boonei genome (CP000780)

    • Compare syntenic regions across related methanogenic archaea

    • Identify consistently co-localized genes that suggest functional relationships

  • Operon Structure Prediction:

    • Determine if Mboo_0842 is part of a polycistronic transcription unit

    • Analyze intergenic distances and orientation of neighboring genes

    • Search for potential promoter and terminator sequences

  • Phylogenetic Profiling:

    • Compare the presence/absence pattern of Mboo_0842 across diverse genomes

    • Identify genes with similar phylogenetic distribution

    • Correlate evolutionary conservation patterns with environmental adaptations

Functional Study Design Based on Genomic Context:

Based on the designation as UPF0290 and the alternative name "carS" , along with its predicted membrane association, several functional hypotheses emerge:

  • Membrane Transport Functions:

    • Design fluorescent substrate uptake assays

    • Prepare proteoliposomes with reconstituted Mboo_0842

    • Measure transport activities under various conditions

  • Stress Response and Environmental Adaptation:

    • Express Mboo_0842 in heterologous hosts

    • Challenge with environmental stressors (pH, temperature, salts)

    • Assess survival rates compared to controls

  • Protein-Protein Interaction Network Mapping:

    • Based on neighboring genes, select candidates for targeted interaction studies

    • Create a panel of recombinant proteins from the gene neighborhood

    • Perform systematic interaction mapping using pull-down or two-hybrid approaches

  • Transcriptional Response Analysis:

    • Design qPCR assays targeting Mboo_0842 and neighboring genes

    • Expose M. boonei cultures to various environmental conditions

    • Analyze co-regulation patterns to identify functional relationships

Genomic Context FeatureExperimental ApproachExpected Outcome
Co-localization with membrane proteinsMembrane localization studies; transport assaysConfirmation of membrane association and potential transport function
Association with stress response genesStress challenge experimentsRole in adaptation to acidic or nutrient-limited environments
Proximity to methanogenesis pathway genesMetabolic enzyme assays; co-expression analysisConnection to methanogenic metabolism
Conservation in specific methanogen lineagesComparative genomic analysis; complementation studiesInsight into specialization vs. core function

This structured approach linking genomic context to experimental design provides a framework for systematic functional characterization of Mboo_0842.

How should researchers address challenges in solubilizing and maintaining stability of recombinant Mboo_0842?

Membrane-associated proteins like Mboo_0842 present significant challenges for solubilization and stability. Here's a methodological approach to address these challenges:

Solubilization Strategies:

  • Detergent Screening:

    • Test a panel of detergents from different classes:

      • Mild non-ionic detergents (DDM, LMNG)

      • Zwitterionic detergents (CHAPS, LDAO)

      • Peptide-based alternatives (SMA polymers, amphipols)

    • Optimize detergent concentration through systematic testing

    • Evaluate protein function retention after solubilization

  • Buffer Optimization:

    • Test various buffer systems (HEPES, Tris, phosphate)

    • Screen pH range (6.0-8.5)

    • Evaluate the effect of ionic strength (100-500 mM NaCl)

    • Assess stabilizing additives (glycerol, specific lipids)

Stability Enhancement Approaches:

  • Storage Conditions:

    • Follow established recommendations:

      • Short-term storage at 4°C (up to one week)

      • Long-term storage at -20°C/-80°C in aliquots

      • Avoid repeated freeze-thaw cycles

      • Use 50% glycerol as a cryoprotectant

  • Structural Stabilization:

    • Add specific lipids that mimic the native membrane environment

    • Incorporate stabilizing mutations based on computational predictions

    • Consider fusion partners that enhance folding and stability

    • Test nanodiscs or liposome reconstitution for native-like membrane context

Troubleshooting Decision Tree:

When facing solubility or stability issues with Mboo_0842, follow this systematic approach:

  • Problem: Protein aggregation during expression

    • Solution: Reduce expression temperature (16-20°C)

    • Solution: Co-express with chaperones

    • Solution: Use solubility-enhancing fusion tags (MBP, SUMO)

  • Problem: Precipitation during purification

    • Solution: Maintain detergent above critical micelle concentration

    • Solution: Add glycerol (10-25%) to all buffers

    • Solution: Include specific lipids (E. coli extract or synthetic mixtures)

    • Solution: Adjust ionic strength to optimize stability

  • Problem: Loss of activity during storage

    • Solution: Store protein in 50% glycerol at -80°C

    • Solution: Lyophilize protein for extended storage

    • Solution: Add reducing agents if cysteine residues are present

    • Solution: Optimize buffer pH based on stability testing

IssuePrimary ApproachAlternative StrategySuccess Indicator
Poor solubilityScreen detergent panelUse stronger solubilization agents with refolding>80% protein in soluble fraction
Aggregation during purificationAdd stabilizing additivesModify purification protocol speedMonodisperse peak on size exclusion
Storage instabilityOptimize buffer conditionsTest lyophilizationRetention of structure/function after storage
Activity lossInclude cofactorsReconstitute in lipid environmentPreserved functional assay results

By systematically addressing these challenges, researchers can improve the yield, purity, and stability of recombinant Mboo_0842 for structural and functional studies.

What control experiments should be included when studying the potential role of Mboo_0842 in methanogenesis?

When investigating the potential role of Mboo_0842 in methanogenesis, a robust experimental design with appropriate controls is essential. The following methodological framework outlines comprehensive control strategies for various experimental approaches:

Functional Assays Controls:

  • Positive Controls:

    • Well-characterized proteins from the methanogenesis pathway (e.g., methyl-coenzyme M reductase components)

    • Related proteins with known function from other methanogenic archaea

    • Native M. boonei cell extracts with verified methanogenic activity

  • Negative Controls:

    • Heat-denatured Mboo_0842 protein

    • Unrelated proteins expressed and purified using the same system

    • Buffer-only samples to establish baseline measurements

  • Specificity Controls:

    • Site-directed mutants of key predicted functional residues

    • Truncated protein variants missing predicted functional domains

    • Homologous proteins from non-methanogenic organisms

Experimental Design for Methane Production Assays:

Experimental ConditionPurposeExpected Outcome if Involved in Methanogenesis
Wild-type Mboo_0842 + methanogenesis substratesTest direct involvementEnhanced methane production
Mboo_0842 + methanogenesis enzyme cocktailTest cooperative effectsSynergistic increase in activity
Mboo_0842 mutants + substratesTest structure-function relationshipReduced activity with mutations in key residues
Heat-denatured Mboo_0842Control for non-specific effectsNo enhancement of methane production
Heterologous expression in methanogensTest in vivo functionAltered methanogenesis rates

Pathway Analysis Controls:

  • Metabolic Intermediate Measurements:

    • Monitor levels of key methanogenesis intermediates (e.g., methyl-CoM, methyl-H4MPT)

    • Compare metabolite profiles with and without Mboo_0842 activity

    • Include conditions with known inhibitors of specific methanogenesis steps

  • Transcriptional and Protein Expression Analysis:

    • Measure co-expression patterns with known methanogenesis genes

    • Compare expression under conditions that induce or repress methanogenesis

    • Include samples from multiple growth phases to capture temporal regulation

  • Interaction Studies Controls:

    • Test interaction with known methanogenesis pathway components

    • Include unrelated membrane proteins as negative controls

    • Use deletion constructs to map interaction domains

Statistical Considerations:

  • Perform all experiments with a minimum of three biological replicates

  • Include technical replicates for each measurement

  • Apply appropriate statistical tests (t-test, ANOVA) to determine significance

  • Establish clear criteria for defining positive results (typically p < 0.05)

This comprehensive control strategy will help researchers distinguish between direct involvement in methanogenesis, indirect effects, and experimental artifacts when characterizing the function of Mboo_0842.

How can researchers differentiate between direct and indirect effects when analyzing the phenotypes associated with Mboo_0842 manipulation?

Differentiating between direct and indirect effects in protein function studies is crucial for accurate interpretation of results. For Mboo_0842, this distinction is particularly important given its potential membrane association and possible regulatory role. The following methodological framework provides a systematic approach:

Time-Course Analysis Strategy:

  • Temporal Resolution of Events:

    • Measure changes at multiple time points after Mboo_0842 manipulation

    • Establish a timeline of molecular and physiological changes

    • Direct effects typically occur rapidly, while indirect effects emerge later

    • Develop a temporal map correlating primary and secondary responses

  • Dose-Response Relationships:

    • Titrate Mboo_0842 levels (in overexpression or knockdown studies)

    • Analyze how phenotypic changes correlate with protein levels

    • Direct effects often show proportional relationships to protein concentration

    • Determine threshold levels required for phenotype manifestation

Molecular Mechanism Dissection:

  • Protein-Protein Interaction Analysis:

    • Identify direct binding partners through techniques outlined in section 3.2

    • Create interaction-deficient mutants that maintain structural integrity

    • Compare phenotypes between wild-type and interaction-deficient variants

    • Direct effects should be abolished in interaction-deficient mutants

  • Structure-Function Analysis:

    • Design a panel of Mboo_0842 variants with targeted mutations

    • Test each variant for:

      • Structural integrity (circular dichroism, thermal stability)

      • Biochemical activities (binding, enzymatic function)

      • Cellular phenotypes (growth, methane production)

    • Map functional domains that directly contribute to specific phenotypes

Complementation and Rescue Experiments:

  • Genetic Complementation:

    • Generate Mboo_0842 knockout or knockdown strains (if genetic systems available)

    • Reintroduce wild-type or mutant versions of the protein

    • Assess which phenotypes are restored by complementation

    • Direct effects should be immediately rescued by wild-type protein reintroduction

  • Biochemical Rescue:

    • Add purified metabolites or signaling molecules to bypass the need for Mboo_0842

    • Test whether cellular phenotypes can be rescued without the protein

    • Identify the specific biochemical step that requires Mboo_0842 function

Decision Matrix for Effect Classification:

Evidence CategoryIndicators of Direct EffectIndicators of Indirect Effect
TemporalRapid response (minutes to hours)Delayed response (hours to days)
Dose-dependencyLinear relationship with protein levelsThreshold effect or non-linear relationship
Molecular interactionsPhysical interaction with affected targetsNo detectable physical interaction
Mutational analysisSpecific residues/domains affect functionBroad structural changes required
ComplementationImmediate rescue upon reintroductionGradual restoration of phenotype
Biochemical bypassCannot be bypassed by metabolite additionCan be rescued by specific metabolites

Integrated Analysis Approach:

To reach a conclusive determination, evidence from multiple categories should be integrated. A scoring system can be applied:

  • Strong evidence for direct effect: Positive indicators in ≥4 categories

  • Probable direct effect: Positive indicators in 3 categories

  • Indeterminate: Mixed evidence across categories

  • Probable indirect effect: Negative indicators in 3 categories

  • Strong evidence for indirect effect: Negative indicators in ≥4 categories

This systematic approach provides a robust framework for distinguishing direct from indirect effects of Mboo_0842 on cellular phenotypes, enabling more accurate functional characterization of this poorly understood protein.

How do the properties of Mboo_0842 compare with homologous proteins in other methanogenic archaea?

Understanding the evolutionary context of Mboo_0842 requires systematic comparative analysis with homologous proteins across diverse methanogenic archaea. This comparative approach provides insights into conserved functions and species-specific adaptations:

Sequence Conservation Analysis:

Homology searches using BLAST or HMM-based approaches identify UPF0290 family members across archaeal genomes. Key features include:

  • Core Conserved Domains:

    • Transmembrane domains appear to be highly conserved

    • N-terminal region shows higher sequence conservation than C-terminal region

    • Specific motifs likely corresponding to functional sites show stricter conservation

  • Species-Specific Variations:

    • Acidophilic methanogens (like M. boonei) may show adaptations in surface-exposed residues

    • Length variations often occur in loop regions between structural elements

    • Charge distribution patterns may reflect adaptation to specific environmental niches

Comparative Structural Predictions:

Using homology modeling and structural prediction algorithms, functional insights emerge:

OrganismProtein IDPredicted StructureKey Differences from Mboo_0842Environmental Niche
M. booneiMboo_0842Primarily α-helical with membrane-spanning domainsReference sequenceAcidic peat bog
M. formicicaUPF0290 homologSimilar core structure with modified surface loopsVariations in predicted surface chargeGranular sludge from brewery effluent
Related methanogensUPF0290 family membersConserved fold with species-specific surface featuresVariable terminal extensions; modified loop regionsDiverse anaerobic environments

Functional Divergence Analysis:

  • Constraint-based Analysis:

    • Calculate evolutionary rates for each position in multiple sequence alignments

    • Identify sites under positive or purifying selection

    • Map these sites to structural models to infer functional importance

  • Co-evolution Networks:

    • Identify co-evolving residue networks within the protein

    • Map potential functional coupling between distant regions

    • Predict residue interactions important for function

Expression Pattern Comparison:

When available, transcriptomic data can reveal:

  • Differential expression patterns across growth conditions

  • Co-expression with different pathway components in various species

  • Potential functional divergence through modified regulation

Ecological Context Analysis:

The environmental niche of the organism provides important context:

  • M. boonei thrives in acidic peat bogs (pH approximately 4.5-5.5)

  • Related methanogens inhabit diverse environments from marine sediments to animal digestive tracts

  • Functional adaptations may correspond to specific ecological pressures

This comprehensive comparative analysis framework enables researchers to distinguish between conserved core functions of the UPF0290 family and specific adaptations in Mboo_0842 that might reflect its ecological niche in acidic peat bogs.

What is the evolutionary history of the UPF0290 protein family and its distribution across microbial taxa?

Phylogenetic Distribution Analysis:

  • Taxonomic Range:

    • UPF0290 family members appear primarily in the archaeal domain

    • Particularly prevalent in methanogenic archaea

    • May have distant homologs in specific bacterial lineages

  • Copy Number Variation:

    • Some archaeal genomes contain single copies (like M. boonei)

    • Others may have undergone gene duplication, resulting in paralogs with potential functional diversification

    • Copy number often correlates with genome size and metabolic versatility

Evolutionary Rate Analysis:

  • Conservation Patterns:

    • Core regions show higher sequence conservation, suggesting functional constraints

    • Terminal regions and exposed loops exhibit higher evolutionary rates

    • Transmembrane domains typically show intermediate conservation (structural constraints with some adaptive variation)

  • Selection Pressure Mapping:

    • Calculate dN/dS ratios across the protein sequence

    • Identify regions under purifying selection (functionally constrained)

    • Detect potential sites of positive selection (adaptive evolution)

Evolutionary Trajectory Reconstruction:

The evolutionary history of UPF0290 can be modeled through:

  • Phylogenetic Tree Construction:

    • Multiple sequence alignment of homologs across diverse taxa

    • Maximum likelihood or Bayesian inference methods for tree building

    • Reconciliation with species trees to identify potential horizontal gene transfer events

  • Ancestral Sequence Reconstruction:

    • Infer the most likely sequence of ancestral UPF0290 proteins

    • Track the accumulation of mutations along evolutionary lineages

    • Identify key transitions that may correspond to functional shifts

Genomic Context Evolution:

  • Synteny Analysis:

    • Compare gene neighborhoods across diverse genomes

    • Track the conservation or rearrangement of genomic context

    • Identify consistently co-evolving gene clusters

  • Operon Structure Comparison:

    • Determine if UPF0290 genes are consistently found in operons

    • Analyze whether operon composition changes across lineages

    • Infer potential functional associations from conserved gene clusters

Evolutionary Timeline Model:

Based on the available data, a theoretical evolutionary model for UPF0290 might include:

  • Ancient Origin: Likely present in the last common ancestor of methanogenic archaea

  • Functional Specialization: Adaptation to specific environmental niches (e.g., acidic environments for M. boonei)

  • Selective Constraints: Core functional regions maintained through purifying selection

  • Adaptive Evolution: Surface-exposed regions modified to accommodate specific cellular contexts

This evolutionary perspective provides a framework for understanding both the conserved functional core of UPF0290 proteins and the specific adaptations that might make Mboo_0842 uniquely suited to its ecological niche in acidic peat bogs.

How might understanding Mboo_0842 contribute to broader research on methanogenesis and climate change?

Methanogens play a significant role in global carbon cycling and greenhouse gas emissions. Understanding the function of Mboo_0842 and similar proteins could have important implications for climate science and methane mitigation strategies:

Climate Science Connections:

  • Methane Production Dynamics:

    • If Mboo_0842 influences methanogenesis efficiency or regulation, it could affect methane emission models

    • Understanding acidophilic methanogens like M. boonei is particularly relevant for peatland methane emissions

    • Peatlands store approximately 30% of global soil carbon, making them critical ecosystems for climate studies

  • Environmental Adaptation Mechanisms:

    • M. boonei's adaptation to acidic environments represents an important ecological niche

    • Climate change is altering peatland hydrology and chemistry, potentially affecting methanogen communities

    • Understanding molecular adaptations could help predict community shifts under changing conditions

Potential Research Applications:

  • Methane Mitigation Strategies:

    • If Mboo_0842 is found to be essential for methanogenesis, it could become a target for:

      • Biomonitoring of methanogenic potential in environmental samples

      • Development of specific inhibitors for methane production

      • Modeling interventions in high-methane environments like rice paddies or wetlands

  • Biotechnological Applications:

    • Engineered methanogens with modified Mboo_0842 could potentially:

      • Enhance methane production for biogas applications

      • Alter substrate specificity for bioremediation purposes

      • Function in extreme environments for specialized bioreactor designs

Interdisciplinary Research Opportunities:

The study of Mboo_0842 intersects with multiple research domains:

Research FieldPotential ContributionMethodological Approach
Climate ModelingImproved parameterization of peatland methane emissionsField measurements combined with molecular characterization
Microbial EcologyUnderstanding methanogen community dynamics in acidic environmentsEnvironmental genomics and transcriptomics
Synthetic BiologyEngineering methanogens for optimized methane productionTargeted protein engineering based on structure-function insights
BioremediationDeveloping archaeal systems for remediation of acidic environmentsFunctional characterization in environmental contexts

Future Research Directions:

  • Field-to-Laboratory Studies:

    • Correlate Mboo_0842 expression in environmental samples with methane flux measurements

    • Examine how environmental perturbations affect expression patterns

    • Develop molecular markers for monitoring functional potential in field studies

  • Comparative Systems Biology:

    • Integrate Mboo_0842 into methanogenesis pathway models

    • Compare regulatory networks across diverse methanogenic archaea

    • Identify critical control points in methane production pathways

By connecting molecular-level understanding of proteins like Mboo_0842 to ecosystem-level processes, researchers can develop more accurate climate models and potentially identify intervention points for methane mitigation strategies.

What are the most promising future directions for research on Mboo_0842 and related proteins?

Based on current knowledge gaps and emerging technologies, several promising research directions could advance our understanding of Mboo_0842 and the broader UPF0290 protein family:

Structural Biology Frontiers:

  • Cryo-EM Studies:

    • Determine the full structure of Mboo_0842 in a membrane environment

    • Visualize potential conformational changes under different conditions

    • Capture protein-protein interaction complexes in near-native states

  • Integrative Structural Biology:

    • Combine multiple techniques (X-ray crystallography, NMR, crosslinking-MS)

    • Generate comprehensive structural models incorporating dynamics

    • Map functional domains through structure-guided mutagenesis

Functional Genomics Approaches:

  • CRISPR-Based Technologies for Archaeal Systems:

    • Develop efficient genome editing tools for M. boonei

    • Create knockout and knockdown strains of Mboo_0842

    • Perform genome-wide screens for synthetic lethal interactions

  • High-Throughput Phenotyping:

    • Design reporter systems for methanogenesis pathway activity

    • Perform large-scale phenotypic screening of Mboo_0842 variants

    • Identify conditions that modify protein function or expression

Systems Biology Integration:

  • Multi-Omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Build comprehensive models of methanogenesis regulation

    • Position Mboo_0842 within broader cellular networks

  • Pathway Modeling:

    • Develop quantitative models of methanogenesis including Mboo_0842

    • Simulate effects of environmental perturbations

    • Predict optimal conditions for specific methanogenic processes

Technological Innovations with High Potential:

TechnologyApplication to Mboo_0842 ResearchExpected Outcome
Single-molecule trackingVisualize protein dynamics in living cellsReal-time understanding of localization and mobility
MicrofluidicsPrecise control of growth environmentsFine-scale analysis of environmental response
Protein engineeringCreate biosensors based on Mboo_0842Tools for monitoring protein activity in vivo
AI-driven structural predictionGenerate accurate models from limited dataImproved functional hypotheses for targeted testing

Collaborative Research Frameworks:

  • Interdisciplinary Consortia:

    • Bring together microbiologists, structural biologists, and climate scientists

    • Develop standardized protocols for methanogen research

    • Create shared resources for difficult-to-cultivate organisms

  • Environmental Genomics Integration:

    • Connect laboratory findings to environmental samples

    • Track natural variants of Mboo_0842 across diverse ecosystems

    • Correlate genetic variation with environmental parameters

The most promising research will likely combine cutting-edge structural and functional approaches with ecological context, connecting molecular mechanisms to ecosystem processes and potential biotechnological applications.

What specialized techniques are required for culturing and maintaining Methanoregula boonei in laboratory settings?

Successfully cultivating and maintaining Methanoregula boonei requires specialized techniques due to its strict anaerobic nature, slow growth, and specific nutritional requirements. The following comprehensive methodology addresses the key challenges:

Anaerobic Cultivation Techniques:

  • Establishing Anaerobic Conditions:

    • Use dedicated anaerobic chambers (e.g., Coy Laboratory Products, Vinyl Anaerobic Chambers)

    • Maintain atmosphere of N2/CO2/H2 (typically 80:10:10 or similar ratios)

    • Monitor oxygen levels using indicators (resazurin) and oxygen sensors

    • Pre-reduce all media and solutions by boiling and gassing with N2/CO2

  • Media Preparation:

    • Use Medium 1280 as recommended by DSMZ for optimal growth

    • Ensure strict anaerobic technique during preparation:

      • Boil medium to remove dissolved oxygen

      • Cool under anaerobic gas stream

      • Add reducing agents (e.g., cysteine-HCl, Na2S)

      • Distribute into pre-gassed tubes or bottles

      • Use butyl rubber stoppers and aluminum crimp seals

Growth Monitoring Strategies:

  • Direct Cell Counting:

    • Use phase contrast microscopy as growth occurs without visible turbidity

    • Employ fluorescent nucleic acid stains (e.g., SYBR Gold, DAPI) for enhanced visualization

    • Consider automated cell counting systems for consistent results

  • Methane Production Measurement:

    • Use gas chromatography to quantify methane in the headspace

    • Implement real-time methane sensors for continuous monitoring

    • Calculate methane production rates as proxy for growth

Temperature and pH Control:

  • Optimal Growth Conditions:

    • Maintain temperature at 28°C (optimal growth temperature)

    • Monitor pH regularly (likely near neutral based on related species)

    • Use appropriately buffered media to maintain pH stability

  • Environmental Parameter Monitoring:

    • Implement continuous temperature logging

    • Consider pH monitoring for long-term cultures

    • Maintain consistent gas pressure in sealed vessels

Long-Term Maintenance Protocols:

  • Regular Subculturing:

    • Transfer cultures every 3-4 weeks (considering >14 day incubation period)

    • Maintain multiple parallel cultures to prevent loss

    • Use at least 10% inoculum for transfers

  • Preservation Methods:

    • Cryopreservation at -80°C with 10-15% glycerol or DMSO

    • Storage of sealed culture tubes at 4°C for medium-term maintenance

    • Development of freeze-drying protocols with appropriate protectants

Troubleshooting Common Issues:

ProblemPotential CausesSolutions
No growth observedOxygen contaminationCheck seals, increase reducing agents, verify anaerobic conditions
Slow/limited growthSuboptimal mediumSupplement with potential growth factors (yeast extract, rumen fluid)
Culture contaminationInadequate sterile techniqueImplement more rigorous sterile procedures, use selective antibiotics
Loss of viability during storageImproper preservationOptimize cryoprotectant concentration, control freezing rate

Advanced Cultivation Approaches:

  • Bioreactor Systems:

    • Implement specialized anaerobic bioreactors

    • Provide continuous H2/CO2 gas supply

    • Monitor and control pH, temperature, and redox potential

    • Enable higher biomass production for experimental applications

  • Co-Culture Systems:

    • Establish defined co-cultures with syntrophic partners

    • Investigate potential growth enhancement through interspecies interactions

    • Model natural environmental conditions more accurately

These specialized techniques address the unique challenges of M. boonei cultivation and provide a foundation for successful laboratory maintenance and experimental manipulation of this fastidious methanogenic archaeon.

What are the key knowledge gaps and research priorities for understanding Mboo_0842 function?

Despite advancing research on methanogenic archaea, significant knowledge gaps remain regarding Mboo_0842 function. This section outlines the most critical unanswered questions and research priorities to advance understanding of this protein:

Critical Knowledge Gaps:

  • Fundamental Function:

    • The primary molecular function of Mboo_0842 remains uncharacterized

    • Its designation as UPF0290 reflects this uncertainty about its precise role

    • Whether it functions as an enzyme, transporter, or regulatory protein is unknown

    • The significance of its alternative name "carS" has not been fully explained in literature

  • Structural Information:

    • No experimental structure exists for Mboo_0842 or close homologs

    • The membrane topology and potential functional domains remain predictions

    • Structural changes under different environmental conditions are unexplored

  • Biological Context:

    • Direct interaction partners in M. boonei have not been identified

    • Regulation of expression under different environmental conditions is uncharacterized

    • Potential involvement in methanogenesis pathways remains speculative

Research Priorities:

Based on these knowledge gaps, the following research priorities emerge:

  • Structural Characterization:

    • Determine three-dimensional structure through X-ray crystallography or cryo-EM

    • Map membrane topology using biochemical approaches

    • Identify potential ligand binding sites and active centers

  • Functional Assignment:

    • Develop robust assays to test hypothesized functions

    • Create knockout or knockdown systems to assess phenotypic consequences

    • Identify direct interaction partners in the native cellular context

  • Environmental Relevance:

    • Examine expression patterns under varying environmental conditions

    • Correlate presence/absence of Mboo_0842 with ecological parameters

    • Assess contribution to M. boonei's adaptation to acidic peat bog environments

Methodological Priorities:

Research ObjectiveKey MethodologyExpected Impact
Structure determinationCryo-EM of membrane-embedded proteinFoundation for structure-based functional hypotheses
Functional assignmentDevelopment of genetic tools for M. booneiDirect assessment of physiological role
Interaction mappingComprehensive interactome analysisPositioning within cellular pathways
Environmental significanceField studies with molecular monitoringConnection between lab findings and ecological relevance

Integrated Research Strategy:

To address these priorities, an integrated research strategy should:

  • Combine structural biology with functional genomics

  • Develop improved genetic tools for methanogenic archaea

  • Connect laboratory findings with environmental contexts

  • Apply systems biology approaches to position Mboo_0842 within broader cellular networks

By addressing these knowledge gaps, researchers will advance understanding not only of Mboo_0842 but also the broader biology of methanogenic archaea and their ecological significance in carbon cycling and climate processes.

How can researchers optimize their experimental approaches when working with recombinant Mboo_0842?

Optimizing experimental approaches for recombinant Mboo_0842 requires careful consideration of its properties as a potential membrane protein from an archaeal source. The following integrated strategy provides a framework for maximizing experimental success:

Expression System Optimization:

  • Host Selection:

    • E. coli remains the preferred system for initial expression

    • Consider specialized E. coli strains:

      • C41(DE3) or C43(DE3) for membrane proteins

      • Rosetta strains for rare codon usage

      • SHuffle strains if disulfide bonds are present

    • For challenging cases, consider archaeal expression hosts or cell-free systems

  • Expression Construct Design:

    • Codon-optimize sequence for E. coli expression

    • Test multiple fusion tags:

      • N-terminal: His6, MBP, SUMO, GST

      • C-terminal: His6, FLAG, Strep-II

    • Include TEV or other protease cleavage sites for tag removal

    • Consider signal sequence modifications for membrane targeting

Purification Strategy Refinement:

  • Extraction Optimization:

    • Test detergent panel for solubilization:

      • Mild detergents: DDM, LMNG, CHAPS

      • More stringent options: SDS, sarkosyl (with refolding)

    • Optimize detergent concentration and buffer conditions

    • Consider native lipid co-extraction to maintain stability

  • Chromatography Sequence:

    • Implement multi-step purification strategy:

      • Initial capture: IMAC or affinity chromatography based on tag

      • Intermediate: Ion exchange chromatography

      • Final polishing: Size exclusion chromatography

    • Monitor protein quality at each step via SDS-PAGE and activity assays

Stability Enhancement:

  • Buffer Optimization:

    • Systematic testing of:

      • Buffer systems (HEPES, Tris, phosphate)

      • pH range (6.0-8.0)

      • Salt concentration (100-500 mM)

      • Additives (glycerol, specific lipids, reducing agents)

    • Use thermal shift assays to quantify stability improvements

  • Storage Conditions:

    • Follow established recommendations:

      • Short-term (≤1 week): 4°C

      • Long-term: -20°C/-80°C with 50% glycerol

      • Consider lyophilization for extended storage

    • Aliquot to avoid freeze-thaw cycles

Functional Assay Design:

  • Activity Assessment:

    • Develop multiple assay formats based on predicted function:

      • Binding assays for potential ligands

      • Transport assays if membrane transport function is suspected

      • Enzymatic activity tests based on genomic context predictions

    • Include appropriate positive and negative controls

    • Validate activity using multiple independent methods

  • Structural Analysis:

    • Employ complementary structural techniques:

      • Circular dichroism for secondary structure

      • Size exclusion chromatography for oligomeric state

      • Thermal denaturation for stability assessment

      • Advanced methods (X-ray, NMR, cryo-EM) for detailed structure

Decision Tree for Common Challenges:

ChallengeFirst-Line ApproachAlternative StrategySuccess Metric
Low expressionLower temperature (16-20°C)Test alternative promoters/host strains≥1 mg/L culture yield
Inclusion body formationCo-express with chaperonesRefold from inclusion bodies≥50% recovery of active protein
Protein aggregationOptimize detergent/buffer conditionsAdd stabilizing ligandsMonodisperse SEC profile
Activity loss during purificationInclude cofactors throughout purificationReconstitute in nanodiscs or liposomesRetention of ≥70% initial activity

Experimental Design Principles:

  • Systematic Parameter Variation:

    • Change one variable at a time

    • Use factorial design for multi-parameter optimization

    • Document all conditions, even unsuccessful ones

  • Quality Control Integration:

    • Implement regular quality checkpoints throughout workflow

    • Define clear quality criteria for each experimental step

    • Establish minimum quality thresholds for downstream applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.