Species: Methanoregula boonei (strain 6A8)
Uniprot Number: A7I6J9
Tag Info: The tag type is determined during the production process.
Storage Buffer: Tris-based buffer with 50% glycerol.
Storage Conditions: Store at -20°C for short-term and -80°C for long-term storage. Avoid repeated freezing and thawing.
Working Aliquots: Store at 4°C for up to one week.
Amino Acid Sequence: MVPAYIPNPVAALCGGGTPIDFCRNYTDGRRILGNGKTYRGLICGVLAGVLIGLVQIWLV GTYHWDLPRQTILSVTLLALGALLGDMGKSFIKRRLGKERGEAWPVADQYDLVVGAFLLT IIFDPAWFFAVVTLPVLIAILVITPVLHRSVNILGYWIKVKKEPW .
| Characteristic | Description |
|---|---|
| Species | Methanoregula boonei (strain 6A8) |
| Uniprot Number | A7I6J9 |
| Tag Info | Determined during production |
| Storage Buffer | Tris-based buffer with 50% glycerol |
| Storage Conditions | -20°C or -80°C |
| Amino Acid Sequence | Provided in section 2 |
| Application/Direction | Description |
|---|---|
| Biotechnology | Potential use in methanogenesis studies or as a molecular tool |
| Microbiological Research | Study of archaeal metabolism and survival mechanisms |
| ELISA Assays | Use in immunoassays for detection or quantification |
KEGG: mbn:Mboo_0842
STRING: 456442.Mboo_0842
Methanoregula boonei is a methane-producing archaeon originally isolated from an acidic, ombrotrophic peat bog (McLean bog) near Ithaca, New York, United States. It was first sampled in August 2003 and is classified as strain 6A8 (DSM 21154, JCM 14090). The organism is categorized as a type strain within the order Methanomicrobiales . M. boonei is part of the archaeal domain, specifically within the Methanobacteriati phylum, Stenosarchaea group, and Methanomicrobia class .
The organism requires specific anaerobic cultivation conditions, with optimal growth occurring at 28°C in Medium 1280. An important characteristic to note is that growth typically occurs without visible increase in turbidity, necessitating phase contrast microscopy to verify cell proliferation. The standard incubation period exceeds 14 days, reflecting its slow growth rate common to many methanogenic archaea .
Methanoregula boonei belongs to the following taxonomic lineage:
Domain: Archaea
Phylum: Methanobacteriati
Class: Methanomicrobia
Order: Methanomicrobiales
Family: Methanoregulaceae
Genus: Methanoregula
The closest related species is Methanoregula formicica, which shares 96.3% 16S rRNA gene sequence similarity and 85.4% deduced McrA amino acid sequence similarity with M. boonei. While these percentages indicate they are different species within the same genus, they share several phenotypic properties, including similar cell morphology and growth temperature ranges .
M. formicica strain SMSPT was isolated from an anaerobic, propionate-degrading enrichment culture originally obtained from granular sludge in a mesophilic upflow anaerobic sludge blanket reactor used to treat beer brewery effluent. Unlike M. boonei, which is found in acidic peat bogs, M. formicica has adapted to different environmental conditions while maintaining core methanogenic metabolic pathways .
Based on available research data, the optimal expression and purification protocol for recombinant Mboo_0842 involves the following methodological approaches:
Expression System:
E. coli is the preferred heterologous expression system for this archaeal protein . When designing expression constructs, researchers should consider:
Codon optimization for E. coli to address potential rare codon usage in archaeal genes
Including a fusion tag (determined during manufacturing process) to facilitate purification
Using inducible promoter systems (such as T7 or tac) to control expression levels
Purification Strategy:
The recombinant protein can be purified to >85% homogeneity using SDS-PAGE analysis . The typical workflow includes:
Cell lysis: Sonication or pressure-based disruption in an appropriate buffer system
Initial capture: Affinity chromatography based on the fusion tag
Polishing step: Size exclusion or ion exchange chromatography
Quality control: SDS-PAGE and potentially mass spectrometry verification
Storage Conditions:
For optimal stability, the purified protein should be stored in a Tris-based buffer with 50% glycerol . Storage recommendations include:
Short-term (up to one week): 4°C
Long-term: -20°C or -80°C in aliquots to avoid repeated freeze-thaw cycles
Reconstitution concentration: 0.1-1.0 mg/mL in deionized sterile water with 5-50% glycerol
The shelf life varies based on storage conditions: approximately 6 months for liquid formulations and 12 months for lyophilized preparations when stored at -20°C/-80°C .
Determining the function of UPF0290 protein Mboo_0842 requires a multi-faceted experimental approach. The "UPF" designation (Uncharacterized Protein Family) indicates that its function remains largely unknown. Based on current research methodologies, the following experimental strategies are recommended:
Computational Analysis:
Conduct comparative sequence analysis with proteins of known function across diverse organisms
Employ structural prediction tools to identify potential functional domains
Use gene neighborhood analysis to identify conserved genomic context that might suggest function
Analyze protein-protein interaction networks through database mining
In vitro Functional Assays:
Binding assays with potential substrates or interacting partners
Enzymatic activity screens based on predicted functional domains
Structural studies including X-ray crystallography or cryo-EM to determine three-dimensional structure
In vivo Approaches:
Gene knockout/knockdown studies in M. boonei (if genetic systems are available)
Heterologous expression in model organisms with phenotypic analysis
Transcriptomic analysis to identify co-expressed genes under various conditions
Localization studies using fluorescent protein fusions or immunolocalization
Specific Hypotheses to Test:
Based on sequence characteristics and the "carS" alternative name , this protein may be involved in:
Membrane transport functions
Signal transduction
Methanogenesis pathway regulation
Adaptation to acidic environments
A systematic approach combining these methods would provide the most comprehensive understanding of Mboo_0842's biological function.
Cultivating Methanoregula boonei presents several significant challenges for researchers interested in protein expression studies:
Specific Growth Requirements:
M. boonei requires highly specialized conditions, including:
Strict anaerobic environment (oxygen-free)
Medium 1280 for optimal growth
Narrow temperature range (10-40°C, optimal at 28°C)
Detection of Growth:
Unlike many model organisms, M. boonei growth does not produce visible turbidity in liquid culture, requiring:
Phase contrast microscopy to verify cell proliferation
Alternative growth monitoring techniques (e.g., methane production measurement)
Metabolic Constraints:
As a methanogenic archaeon, M. boonei has specific metabolic requirements:
Limited substrate utilization (primarily formate and hydrogen for growth and methane production)
Specific pH requirements (likely near neutral based on related species M. formicica preferring pH 7.0-7.6)
Technical Solutions:
To overcome these challenges, researchers commonly employ these strategies:
Use specialized anaerobic chambers and gas delivery systems
Implement real-time methane detection as a proxy for growth
Develop defined media formulations with potential growth enhancers
Establish co-culture systems that provide growth factors or remove inhibitory compounds
For protein expression studies specifically, heterologous expression in E. coli is generally more practical than native expression, as demonstrated by the commercial availability of recombinant Mboo_0842 produced in E. coli systems .
Recombinant Mboo_0842 can be utilized in various structural and functional studies to elucidate its biological role. Here are methodological approaches for different research objectives:
Structural Studies:
X-ray Crystallography:
Purify protein to >95% homogeneity
Screen various crystallization conditions (pH, temperature, precipitants)
Optimize crystal formation for high-resolution diffraction
Solve structure using molecular replacement or experimental phasing methods
NMR Spectroscopy (for specific domains):
Produce isotopically labeled protein (15N, 13C)
Perform multidimensional NMR experiments
Determine solution structure of soluble domains
Cryo-EM Analysis:
Particularly useful if the protein forms larger complexes
Prepare vitrified samples on specialized grids
Collect and process image data to generate 3D reconstructions
Functional Studies:
Protein-Protein Interaction Analysis:
Pull-down assays using tagged recombinant protein
Yeast two-hybrid or bacterial two-hybrid screening
Surface plasmon resonance to determine binding kinetics
Crosslinking studies followed by mass spectrometry
Enzymatic Activity Assessment:
Design activity assays based on:
Sequence homology to known enzymes
Structural predictions
Genomic context
Test various potential substrates
Determine optimal reaction conditions (pH, temperature, cofactors)
Experimental Design Considerations:
Use appropriate controls, including:
Heat-denatured protein
Tagged protein without the Mboo_0842 sequence
Related proteins from different organisms
Ensure experimental conditions account for the original environmental context of M. boonei (acidic, anaerobic)
Consider the potential membrane association of this protein when designing solubilization and purification strategies
Analysis of protein-protein interactions (PPIs) involving Mboo_0842 requires a comprehensive approach using complementary techniques. Below is a methodological framework for identifying and characterizing potential interaction partners:
In vitro Interaction Analysis:
Affinity Purification Coupled with Mass Spectrometry (AP-MS):
Express recombinant Mboo_0842 with an affinity tag
Perform pull-down experiments using M. boonei lysate or recombinant proteins
Identify binding partners through mass spectrometry
Validate specific interactions with targeted approaches
Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI):
Immobilize purified Mboo_0842 on sensor chips/tips
Measure real-time binding kinetics with potential partners
Determine association/dissociation constants (ka, kd, KD)
Assess binding under varying conditions (pH, salt, temperature)
Structural Analysis of Complexes:
Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):
Map interaction interfaces through differential deuterium uptake
Identify conformational changes upon binding
Provide structural insights without requiring crystallization
Cross-linking Mass Spectrometry (XL-MS):
Use chemical cross-linkers to capture transient interactions
Identify cross-linked peptides through specialized MS workflows
Generate distance constraints for modeling interaction interfaces
In vivo Interaction Analysis:
Bacterial Two-Hybrid System:
Particularly suitable for archaeal proteins
Create fusion constructs with split reporter proteins
Screen for interactions through reporter activation
Quantify interaction strength through reporter expression levels
| Technique | Advantages | Limitations | Best Application Scenario |
|---|---|---|---|
| AP-MS | Identifies multiple interactions simultaneously | Requires tag; may lose weak interactions | Initial screening for interaction partners |
| SPR/BLI | Provides quantitative binding kinetics | Requires purified proteins | Detailed characterization of specific interactions |
| HDX-MS | Maps interaction interfaces; no crystallization needed | Complex data analysis | Structural characterization of complexes |
| XL-MS | Captures transient interactions | Chemical modification may alter binding | Identifying distant interaction sites |
| Bacterial Two-Hybrid | Detects interactions in cell-like environment | Potential false positives/negatives | Validation of specific interaction pairs |
When designing these experiments, researchers should consider the membrane association prediction for Mboo_0842, which suggests potential interactions with other membrane proteins or lipids that may require specialized solubilization conditions.
Genomic context analysis provides valuable insights for designing functional studies of Mboo_0842. This approach examines neighboring genes, conserved gene clusters, and genomic organization to infer potential functional relationships.
Methodology for Genomic Context Analysis:
Gene Neighborhood Mapping:
Operon Structure Prediction:
Determine if Mboo_0842 is part of a polycistronic transcription unit
Analyze intergenic distances and orientation of neighboring genes
Search for potential promoter and terminator sequences
Phylogenetic Profiling:
Compare the presence/absence pattern of Mboo_0842 across diverse genomes
Identify genes with similar phylogenetic distribution
Correlate evolutionary conservation patterns with environmental adaptations
Functional Study Design Based on Genomic Context:
Based on the designation as UPF0290 and the alternative name "carS" , along with its predicted membrane association, several functional hypotheses emerge:
Membrane Transport Functions:
Design fluorescent substrate uptake assays
Prepare proteoliposomes with reconstituted Mboo_0842
Measure transport activities under various conditions
Stress Response and Environmental Adaptation:
Express Mboo_0842 in heterologous hosts
Challenge with environmental stressors (pH, temperature, salts)
Assess survival rates compared to controls
Protein-Protein Interaction Network Mapping:
Based on neighboring genes, select candidates for targeted interaction studies
Create a panel of recombinant proteins from the gene neighborhood
Perform systematic interaction mapping using pull-down or two-hybrid approaches
Transcriptional Response Analysis:
Design qPCR assays targeting Mboo_0842 and neighboring genes
Expose M. boonei cultures to various environmental conditions
Analyze co-regulation patterns to identify functional relationships
| Genomic Context Feature | Experimental Approach | Expected Outcome |
|---|---|---|
| Co-localization with membrane proteins | Membrane localization studies; transport assays | Confirmation of membrane association and potential transport function |
| Association with stress response genes | Stress challenge experiments | Role in adaptation to acidic or nutrient-limited environments |
| Proximity to methanogenesis pathway genes | Metabolic enzyme assays; co-expression analysis | Connection to methanogenic metabolism |
| Conservation in specific methanogen lineages | Comparative genomic analysis; complementation studies | Insight into specialization vs. core function |
This structured approach linking genomic context to experimental design provides a framework for systematic functional characterization of Mboo_0842.
Membrane-associated proteins like Mboo_0842 present significant challenges for solubilization and stability. Here's a methodological approach to address these challenges:
Solubilization Strategies:
Detergent Screening:
Test a panel of detergents from different classes:
Mild non-ionic detergents (DDM, LMNG)
Zwitterionic detergents (CHAPS, LDAO)
Peptide-based alternatives (SMA polymers, amphipols)
Optimize detergent concentration through systematic testing
Evaluate protein function retention after solubilization
Buffer Optimization:
Test various buffer systems (HEPES, Tris, phosphate)
Screen pH range (6.0-8.5)
Evaluate the effect of ionic strength (100-500 mM NaCl)
Assess stabilizing additives (glycerol, specific lipids)
Stability Enhancement Approaches:
Storage Conditions:
Structural Stabilization:
Add specific lipids that mimic the native membrane environment
Incorporate stabilizing mutations based on computational predictions
Consider fusion partners that enhance folding and stability
Test nanodiscs or liposome reconstitution for native-like membrane context
Troubleshooting Decision Tree:
When facing solubility or stability issues with Mboo_0842, follow this systematic approach:
Problem: Protein aggregation during expression
Solution: Reduce expression temperature (16-20°C)
Solution: Co-express with chaperones
Solution: Use solubility-enhancing fusion tags (MBP, SUMO)
Problem: Precipitation during purification
Solution: Maintain detergent above critical micelle concentration
Solution: Add glycerol (10-25%) to all buffers
Solution: Include specific lipids (E. coli extract or synthetic mixtures)
Solution: Adjust ionic strength to optimize stability
Problem: Loss of activity during storage
Solution: Store protein in 50% glycerol at -80°C
Solution: Lyophilize protein for extended storage
Solution: Add reducing agents if cysteine residues are present
Solution: Optimize buffer pH based on stability testing
| Issue | Primary Approach | Alternative Strategy | Success Indicator |
|---|---|---|---|
| Poor solubility | Screen detergent panel | Use stronger solubilization agents with refolding | >80% protein in soluble fraction |
| Aggregation during purification | Add stabilizing additives | Modify purification protocol speed | Monodisperse peak on size exclusion |
| Storage instability | Optimize buffer conditions | Test lyophilization | Retention of structure/function after storage |
| Activity loss | Include cofactors | Reconstitute in lipid environment | Preserved functional assay results |
By systematically addressing these challenges, researchers can improve the yield, purity, and stability of recombinant Mboo_0842 for structural and functional studies.
When investigating the potential role of Mboo_0842 in methanogenesis, a robust experimental design with appropriate controls is essential. The following methodological framework outlines comprehensive control strategies for various experimental approaches:
Functional Assays Controls:
Positive Controls:
Well-characterized proteins from the methanogenesis pathway (e.g., methyl-coenzyme M reductase components)
Related proteins with known function from other methanogenic archaea
Native M. boonei cell extracts with verified methanogenic activity
Negative Controls:
Heat-denatured Mboo_0842 protein
Unrelated proteins expressed and purified using the same system
Buffer-only samples to establish baseline measurements
Specificity Controls:
Site-directed mutants of key predicted functional residues
Truncated protein variants missing predicted functional domains
Homologous proteins from non-methanogenic organisms
Experimental Design for Methane Production Assays:
| Experimental Condition | Purpose | Expected Outcome if Involved in Methanogenesis |
|---|---|---|
| Wild-type Mboo_0842 + methanogenesis substrates | Test direct involvement | Enhanced methane production |
| Mboo_0842 + methanogenesis enzyme cocktail | Test cooperative effects | Synergistic increase in activity |
| Mboo_0842 mutants + substrates | Test structure-function relationship | Reduced activity with mutations in key residues |
| Heat-denatured Mboo_0842 | Control for non-specific effects | No enhancement of methane production |
| Heterologous expression in methanogens | Test in vivo function | Altered methanogenesis rates |
Pathway Analysis Controls:
Metabolic Intermediate Measurements:
Monitor levels of key methanogenesis intermediates (e.g., methyl-CoM, methyl-H4MPT)
Compare metabolite profiles with and without Mboo_0842 activity
Include conditions with known inhibitors of specific methanogenesis steps
Transcriptional and Protein Expression Analysis:
Measure co-expression patterns with known methanogenesis genes
Compare expression under conditions that induce or repress methanogenesis
Include samples from multiple growth phases to capture temporal regulation
Interaction Studies Controls:
Test interaction with known methanogenesis pathway components
Include unrelated membrane proteins as negative controls
Use deletion constructs to map interaction domains
Statistical Considerations:
Perform all experiments with a minimum of three biological replicates
Include technical replicates for each measurement
Apply appropriate statistical tests (t-test, ANOVA) to determine significance
Establish clear criteria for defining positive results (typically p < 0.05)
This comprehensive control strategy will help researchers distinguish between direct involvement in methanogenesis, indirect effects, and experimental artifacts when characterizing the function of Mboo_0842.
Differentiating between direct and indirect effects in protein function studies is crucial for accurate interpretation of results. For Mboo_0842, this distinction is particularly important given its potential membrane association and possible regulatory role. The following methodological framework provides a systematic approach:
Time-Course Analysis Strategy:
Temporal Resolution of Events:
Measure changes at multiple time points after Mboo_0842 manipulation
Establish a timeline of molecular and physiological changes
Direct effects typically occur rapidly, while indirect effects emerge later
Develop a temporal map correlating primary and secondary responses
Dose-Response Relationships:
Titrate Mboo_0842 levels (in overexpression or knockdown studies)
Analyze how phenotypic changes correlate with protein levels
Direct effects often show proportional relationships to protein concentration
Determine threshold levels required for phenotype manifestation
Molecular Mechanism Dissection:
Protein-Protein Interaction Analysis:
Identify direct binding partners through techniques outlined in section 3.2
Create interaction-deficient mutants that maintain structural integrity
Compare phenotypes between wild-type and interaction-deficient variants
Direct effects should be abolished in interaction-deficient mutants
Structure-Function Analysis:
Design a panel of Mboo_0842 variants with targeted mutations
Test each variant for:
Structural integrity (circular dichroism, thermal stability)
Biochemical activities (binding, enzymatic function)
Cellular phenotypes (growth, methane production)
Map functional domains that directly contribute to specific phenotypes
Complementation and Rescue Experiments:
Genetic Complementation:
Generate Mboo_0842 knockout or knockdown strains (if genetic systems available)
Reintroduce wild-type or mutant versions of the protein
Assess which phenotypes are restored by complementation
Direct effects should be immediately rescued by wild-type protein reintroduction
Biochemical Rescue:
Add purified metabolites or signaling molecules to bypass the need for Mboo_0842
Test whether cellular phenotypes can be rescued without the protein
Identify the specific biochemical step that requires Mboo_0842 function
Decision Matrix for Effect Classification:
| Evidence Category | Indicators of Direct Effect | Indicators of Indirect Effect |
|---|---|---|
| Temporal | Rapid response (minutes to hours) | Delayed response (hours to days) |
| Dose-dependency | Linear relationship with protein levels | Threshold effect or non-linear relationship |
| Molecular interactions | Physical interaction with affected targets | No detectable physical interaction |
| Mutational analysis | Specific residues/domains affect function | Broad structural changes required |
| Complementation | Immediate rescue upon reintroduction | Gradual restoration of phenotype |
| Biochemical bypass | Cannot be bypassed by metabolite addition | Can be rescued by specific metabolites |
Integrated Analysis Approach:
To reach a conclusive determination, evidence from multiple categories should be integrated. A scoring system can be applied:
Strong evidence for direct effect: Positive indicators in ≥4 categories
Probable direct effect: Positive indicators in 3 categories
Indeterminate: Mixed evidence across categories
Probable indirect effect: Negative indicators in 3 categories
Strong evidence for indirect effect: Negative indicators in ≥4 categories
This systematic approach provides a robust framework for distinguishing direct from indirect effects of Mboo_0842 on cellular phenotypes, enabling more accurate functional characterization of this poorly understood protein.
Understanding the evolutionary context of Mboo_0842 requires systematic comparative analysis with homologous proteins across diverse methanogenic archaea. This comparative approach provides insights into conserved functions and species-specific adaptations:
Sequence Conservation Analysis:
Homology searches using BLAST or HMM-based approaches identify UPF0290 family members across archaeal genomes. Key features include:
Core Conserved Domains:
Transmembrane domains appear to be highly conserved
N-terminal region shows higher sequence conservation than C-terminal region
Specific motifs likely corresponding to functional sites show stricter conservation
Species-Specific Variations:
Acidophilic methanogens (like M. boonei) may show adaptations in surface-exposed residues
Length variations often occur in loop regions between structural elements
Charge distribution patterns may reflect adaptation to specific environmental niches
Comparative Structural Predictions:
Using homology modeling and structural prediction algorithms, functional insights emerge:
| Organism | Protein ID | Predicted Structure | Key Differences from Mboo_0842 | Environmental Niche |
|---|---|---|---|---|
| M. boonei | Mboo_0842 | Primarily α-helical with membrane-spanning domains | Reference sequence | Acidic peat bog |
| M. formicica | UPF0290 homolog | Similar core structure with modified surface loops | Variations in predicted surface charge | Granular sludge from brewery effluent |
| Related methanogens | UPF0290 family members | Conserved fold with species-specific surface features | Variable terminal extensions; modified loop regions | Diverse anaerobic environments |
Functional Divergence Analysis:
Constraint-based Analysis:
Calculate evolutionary rates for each position in multiple sequence alignments
Identify sites under positive or purifying selection
Map these sites to structural models to infer functional importance
Co-evolution Networks:
Identify co-evolving residue networks within the protein
Map potential functional coupling between distant regions
Predict residue interactions important for function
Expression Pattern Comparison:
When available, transcriptomic data can reveal:
Differential expression patterns across growth conditions
Co-expression with different pathway components in various species
Potential functional divergence through modified regulation
Ecological Context Analysis:
The environmental niche of the organism provides important context:
M. boonei thrives in acidic peat bogs (pH approximately 4.5-5.5)
Related methanogens inhabit diverse environments from marine sediments to animal digestive tracts
Functional adaptations may correspond to specific ecological pressures
This comprehensive comparative analysis framework enables researchers to distinguish between conserved core functions of the UPF0290 family and specific adaptations in Mboo_0842 that might reflect its ecological niche in acidic peat bogs.
Phylogenetic Distribution Analysis:
Taxonomic Range:
UPF0290 family members appear primarily in the archaeal domain
Particularly prevalent in methanogenic archaea
May have distant homologs in specific bacterial lineages
Copy Number Variation:
Some archaeal genomes contain single copies (like M. boonei)
Others may have undergone gene duplication, resulting in paralogs with potential functional diversification
Copy number often correlates with genome size and metabolic versatility
Evolutionary Rate Analysis:
Conservation Patterns:
Core regions show higher sequence conservation, suggesting functional constraints
Terminal regions and exposed loops exhibit higher evolutionary rates
Transmembrane domains typically show intermediate conservation (structural constraints with some adaptive variation)
Selection Pressure Mapping:
Calculate dN/dS ratios across the protein sequence
Identify regions under purifying selection (functionally constrained)
Detect potential sites of positive selection (adaptive evolution)
Evolutionary Trajectory Reconstruction:
The evolutionary history of UPF0290 can be modeled through:
Phylogenetic Tree Construction:
Multiple sequence alignment of homologs across diverse taxa
Maximum likelihood or Bayesian inference methods for tree building
Reconciliation with species trees to identify potential horizontal gene transfer events
Ancestral Sequence Reconstruction:
Infer the most likely sequence of ancestral UPF0290 proteins
Track the accumulation of mutations along evolutionary lineages
Identify key transitions that may correspond to functional shifts
Genomic Context Evolution:
Synteny Analysis:
Compare gene neighborhoods across diverse genomes
Track the conservation or rearrangement of genomic context
Identify consistently co-evolving gene clusters
Operon Structure Comparison:
Determine if UPF0290 genes are consistently found in operons
Analyze whether operon composition changes across lineages
Infer potential functional associations from conserved gene clusters
Evolutionary Timeline Model:
Based on the available data, a theoretical evolutionary model for UPF0290 might include:
Ancient Origin: Likely present in the last common ancestor of methanogenic archaea
Functional Specialization: Adaptation to specific environmental niches (e.g., acidic environments for M. boonei)
Selective Constraints: Core functional regions maintained through purifying selection
Adaptive Evolution: Surface-exposed regions modified to accommodate specific cellular contexts
This evolutionary perspective provides a framework for understanding both the conserved functional core of UPF0290 proteins and the specific adaptations that might make Mboo_0842 uniquely suited to its ecological niche in acidic peat bogs.
Methanogens play a significant role in global carbon cycling and greenhouse gas emissions. Understanding the function of Mboo_0842 and similar proteins could have important implications for climate science and methane mitigation strategies:
Climate Science Connections:
Methane Production Dynamics:
If Mboo_0842 influences methanogenesis efficiency or regulation, it could affect methane emission models
Understanding acidophilic methanogens like M. boonei is particularly relevant for peatland methane emissions
Peatlands store approximately 30% of global soil carbon, making them critical ecosystems for climate studies
Environmental Adaptation Mechanisms:
M. boonei's adaptation to acidic environments represents an important ecological niche
Climate change is altering peatland hydrology and chemistry, potentially affecting methanogen communities
Understanding molecular adaptations could help predict community shifts under changing conditions
Potential Research Applications:
Methane Mitigation Strategies:
If Mboo_0842 is found to be essential for methanogenesis, it could become a target for:
Biomonitoring of methanogenic potential in environmental samples
Development of specific inhibitors for methane production
Modeling interventions in high-methane environments like rice paddies or wetlands
Biotechnological Applications:
Engineered methanogens with modified Mboo_0842 could potentially:
Enhance methane production for biogas applications
Alter substrate specificity for bioremediation purposes
Function in extreme environments for specialized bioreactor designs
Interdisciplinary Research Opportunities:
The study of Mboo_0842 intersects with multiple research domains:
| Research Field | Potential Contribution | Methodological Approach |
|---|---|---|
| Climate Modeling | Improved parameterization of peatland methane emissions | Field measurements combined with molecular characterization |
| Microbial Ecology | Understanding methanogen community dynamics in acidic environments | Environmental genomics and transcriptomics |
| Synthetic Biology | Engineering methanogens for optimized methane production | Targeted protein engineering based on structure-function insights |
| Bioremediation | Developing archaeal systems for remediation of acidic environments | Functional characterization in environmental contexts |
Future Research Directions:
Field-to-Laboratory Studies:
Correlate Mboo_0842 expression in environmental samples with methane flux measurements
Examine how environmental perturbations affect expression patterns
Develop molecular markers for monitoring functional potential in field studies
Comparative Systems Biology:
Integrate Mboo_0842 into methanogenesis pathway models
Compare regulatory networks across diverse methanogenic archaea
Identify critical control points in methane production pathways
By connecting molecular-level understanding of proteins like Mboo_0842 to ecosystem-level processes, researchers can develop more accurate climate models and potentially identify intervention points for methane mitigation strategies.
Based on current knowledge gaps and emerging technologies, several promising research directions could advance our understanding of Mboo_0842 and the broader UPF0290 protein family:
Structural Biology Frontiers:
Cryo-EM Studies:
Determine the full structure of Mboo_0842 in a membrane environment
Visualize potential conformational changes under different conditions
Capture protein-protein interaction complexes in near-native states
Integrative Structural Biology:
Combine multiple techniques (X-ray crystallography, NMR, crosslinking-MS)
Generate comprehensive structural models incorporating dynamics
Map functional domains through structure-guided mutagenesis
Functional Genomics Approaches:
CRISPR-Based Technologies for Archaeal Systems:
Develop efficient genome editing tools for M. boonei
Create knockout and knockdown strains of Mboo_0842
Perform genome-wide screens for synthetic lethal interactions
High-Throughput Phenotyping:
Design reporter systems for methanogenesis pathway activity
Perform large-scale phenotypic screening of Mboo_0842 variants
Identify conditions that modify protein function or expression
Systems Biology Integration:
Multi-Omics Integration:
Combine transcriptomics, proteomics, and metabolomics data
Build comprehensive models of methanogenesis regulation
Position Mboo_0842 within broader cellular networks
Pathway Modeling:
Develop quantitative models of methanogenesis including Mboo_0842
Simulate effects of environmental perturbations
Predict optimal conditions for specific methanogenic processes
Technological Innovations with High Potential:
| Technology | Application to Mboo_0842 Research | Expected Outcome |
|---|---|---|
| Single-molecule tracking | Visualize protein dynamics in living cells | Real-time understanding of localization and mobility |
| Microfluidics | Precise control of growth environments | Fine-scale analysis of environmental response |
| Protein engineering | Create biosensors based on Mboo_0842 | Tools for monitoring protein activity in vivo |
| AI-driven structural prediction | Generate accurate models from limited data | Improved functional hypotheses for targeted testing |
Collaborative Research Frameworks:
Interdisciplinary Consortia:
Bring together microbiologists, structural biologists, and climate scientists
Develop standardized protocols for methanogen research
Create shared resources for difficult-to-cultivate organisms
Environmental Genomics Integration:
Connect laboratory findings to environmental samples
Track natural variants of Mboo_0842 across diverse ecosystems
Correlate genetic variation with environmental parameters
The most promising research will likely combine cutting-edge structural and functional approaches with ecological context, connecting molecular mechanisms to ecosystem processes and potential biotechnological applications.
Successfully cultivating and maintaining Methanoregula boonei requires specialized techniques due to its strict anaerobic nature, slow growth, and specific nutritional requirements. The following comprehensive methodology addresses the key challenges:
Anaerobic Cultivation Techniques:
Establishing Anaerobic Conditions:
Use dedicated anaerobic chambers (e.g., Coy Laboratory Products, Vinyl Anaerobic Chambers)
Maintain atmosphere of N2/CO2/H2 (typically 80:10:10 or similar ratios)
Monitor oxygen levels using indicators (resazurin) and oxygen sensors
Pre-reduce all media and solutions by boiling and gassing with N2/CO2
Media Preparation:
Ensure strict anaerobic technique during preparation:
Boil medium to remove dissolved oxygen
Cool under anaerobic gas stream
Add reducing agents (e.g., cysteine-HCl, Na2S)
Distribute into pre-gassed tubes or bottles
Use butyl rubber stoppers and aluminum crimp seals
Growth Monitoring Strategies:
Direct Cell Counting:
Methane Production Measurement:
Use gas chromatography to quantify methane in the headspace
Implement real-time methane sensors for continuous monitoring
Calculate methane production rates as proxy for growth
Temperature and pH Control:
Optimal Growth Conditions:
Environmental Parameter Monitoring:
Implement continuous temperature logging
Consider pH monitoring for long-term cultures
Maintain consistent gas pressure in sealed vessels
Long-Term Maintenance Protocols:
Regular Subculturing:
Preservation Methods:
Cryopreservation at -80°C with 10-15% glycerol or DMSO
Storage of sealed culture tubes at 4°C for medium-term maintenance
Development of freeze-drying protocols with appropriate protectants
Troubleshooting Common Issues:
| Problem | Potential Causes | Solutions |
|---|---|---|
| No growth observed | Oxygen contamination | Check seals, increase reducing agents, verify anaerobic conditions |
| Slow/limited growth | Suboptimal medium | Supplement with potential growth factors (yeast extract, rumen fluid) |
| Culture contamination | Inadequate sterile technique | Implement more rigorous sterile procedures, use selective antibiotics |
| Loss of viability during storage | Improper preservation | Optimize cryoprotectant concentration, control freezing rate |
Advanced Cultivation Approaches:
Bioreactor Systems:
Implement specialized anaerobic bioreactors
Provide continuous H2/CO2 gas supply
Monitor and control pH, temperature, and redox potential
Enable higher biomass production for experimental applications
Co-Culture Systems:
Establish defined co-cultures with syntrophic partners
Investigate potential growth enhancement through interspecies interactions
Model natural environmental conditions more accurately
These specialized techniques address the unique challenges of M. boonei cultivation and provide a foundation for successful laboratory maintenance and experimental manipulation of this fastidious methanogenic archaeon.
Despite advancing research on methanogenic archaea, significant knowledge gaps remain regarding Mboo_0842 function. This section outlines the most critical unanswered questions and research priorities to advance understanding of this protein:
Critical Knowledge Gaps:
Fundamental Function:
The primary molecular function of Mboo_0842 remains uncharacterized
Its designation as UPF0290 reflects this uncertainty about its precise role
Whether it functions as an enzyme, transporter, or regulatory protein is unknown
The significance of its alternative name "carS" has not been fully explained in literature
Structural Information:
No experimental structure exists for Mboo_0842 or close homologs
The membrane topology and potential functional domains remain predictions
Structural changes under different environmental conditions are unexplored
Biological Context:
Direct interaction partners in M. boonei have not been identified
Regulation of expression under different environmental conditions is uncharacterized
Potential involvement in methanogenesis pathways remains speculative
Research Priorities:
Based on these knowledge gaps, the following research priorities emerge:
Structural Characterization:
Determine three-dimensional structure through X-ray crystallography or cryo-EM
Map membrane topology using biochemical approaches
Identify potential ligand binding sites and active centers
Functional Assignment:
Develop robust assays to test hypothesized functions
Create knockout or knockdown systems to assess phenotypic consequences
Identify direct interaction partners in the native cellular context
Environmental Relevance:
Examine expression patterns under varying environmental conditions
Correlate presence/absence of Mboo_0842 with ecological parameters
Assess contribution to M. boonei's adaptation to acidic peat bog environments
Methodological Priorities:
| Research Objective | Key Methodology | Expected Impact |
|---|---|---|
| Structure determination | Cryo-EM of membrane-embedded protein | Foundation for structure-based functional hypotheses |
| Functional assignment | Development of genetic tools for M. boonei | Direct assessment of physiological role |
| Interaction mapping | Comprehensive interactome analysis | Positioning within cellular pathways |
| Environmental significance | Field studies with molecular monitoring | Connection between lab findings and ecological relevance |
Integrated Research Strategy:
To address these priorities, an integrated research strategy should:
Combine structural biology with functional genomics
Develop improved genetic tools for methanogenic archaea
Connect laboratory findings with environmental contexts
Apply systems biology approaches to position Mboo_0842 within broader cellular networks
By addressing these knowledge gaps, researchers will advance understanding not only of Mboo_0842 but also the broader biology of methanogenic archaea and their ecological significance in carbon cycling and climate processes.
Optimizing experimental approaches for recombinant Mboo_0842 requires careful consideration of its properties as a potential membrane protein from an archaeal source. The following integrated strategy provides a framework for maximizing experimental success:
Expression System Optimization:
Host Selection:
Consider specialized E. coli strains:
C41(DE3) or C43(DE3) for membrane proteins
Rosetta strains for rare codon usage
SHuffle strains if disulfide bonds are present
For challenging cases, consider archaeal expression hosts or cell-free systems
Expression Construct Design:
Codon-optimize sequence for E. coli expression
Test multiple fusion tags:
N-terminal: His6, MBP, SUMO, GST
C-terminal: His6, FLAG, Strep-II
Include TEV or other protease cleavage sites for tag removal
Consider signal sequence modifications for membrane targeting
Purification Strategy Refinement:
Extraction Optimization:
Test detergent panel for solubilization:
Mild detergents: DDM, LMNG, CHAPS
More stringent options: SDS, sarkosyl (with refolding)
Optimize detergent concentration and buffer conditions
Consider native lipid co-extraction to maintain stability
Chromatography Sequence:
Implement multi-step purification strategy:
Initial capture: IMAC or affinity chromatography based on tag
Intermediate: Ion exchange chromatography
Final polishing: Size exclusion chromatography
Monitor protein quality at each step via SDS-PAGE and activity assays
Stability Enhancement:
Buffer Optimization:
Systematic testing of:
Buffer systems (HEPES, Tris, phosphate)
pH range (6.0-8.0)
Salt concentration (100-500 mM)
Additives (glycerol, specific lipids, reducing agents)
Use thermal shift assays to quantify stability improvements
Storage Conditions:
Functional Assay Design:
Activity Assessment:
Develop multiple assay formats based on predicted function:
Binding assays for potential ligands
Transport assays if membrane transport function is suspected
Enzymatic activity tests based on genomic context predictions
Include appropriate positive and negative controls
Validate activity using multiple independent methods
Structural Analysis:
Employ complementary structural techniques:
Circular dichroism for secondary structure
Size exclusion chromatography for oligomeric state
Thermal denaturation for stability assessment
Advanced methods (X-ray, NMR, cryo-EM) for detailed structure
Decision Tree for Common Challenges:
| Challenge | First-Line Approach | Alternative Strategy | Success Metric |
|---|---|---|---|
| Low expression | Lower temperature (16-20°C) | Test alternative promoters/host strains | ≥1 mg/L culture yield |
| Inclusion body formation | Co-express with chaperones | Refold from inclusion bodies | ≥50% recovery of active protein |
| Protein aggregation | Optimize detergent/buffer conditions | Add stabilizing ligands | Monodisperse SEC profile |
| Activity loss during purification | Include cofactors throughout purification | Reconstitute in nanodiscs or liposomes | Retention of ≥70% initial activity |
Experimental Design Principles:
Systematic Parameter Variation:
Change one variable at a time
Use factorial design for multi-parameter optimization
Document all conditions, even unsuccessful ones
Quality Control Integration:
Implement regular quality checkpoints throughout workflow
Define clear quality criteria for each experimental step
Establish minimum quality thresholds for downstream applications