Recombinant Methanoregula boonei UPF0316 protein Mboo_0605 (Mboo_0605) is a protein derived from the archaeon Methanoregula boonei . Methanoregula boonei is an acidophilic, hydrogenotrophic methanogen, meaning it thrives in acidic environments and produces methane from hydrogen and carbon dioxide . The protein is designated as UPF0316, which stands for "Unknown Protein Function 0316," indicating that its specific function is not yet fully understood .
Methanoregula boonei is a novel species of methanogenic archaea first isolated from an acidic bog near Ithaca, NY . This organism exhibits unique adaptations that allow it to survive in acidic, nutrient-poor conditions .
Morphology Methanoregula boonei exhibits a dimorphic morphology, displaying both thin rods (0.2-0.3 μm in diameter and 0.8-3.0 μm long) and irregular cocci (0.2-0.8 μm in diameter) .
Metabolism The archaeon utilizes H2/CO2 to produce methane but cannot use formate, acetate, methanol, ethanol, 2-propanol, butanol, or trimethylamine .
Growth Conditions Optimal growth occurs near pH 5.1 and 35 °C. It can grow in basal medium with low sodium concentrations (0.43 mM Na+), and its growth is inhibited by 50 mM NaCl .
Mboo_0605 is an UPF0316 protein from Methanoregula boonei strain 6A8 . The protein's function is currently unknown, but its sequence and genetic context may provide clues .
Sequence Information The protein consists of 190 amino acids .
AA Sequence MDIGTFWSVAAIPLLILVARIAEASLESVRTIYISKGHANLAAYVGIVKTGIWLISTGLVLTDLMQFWNLFAYLAGYGMGTVLGMEIENLISIGYVIVRLITPSDPQALMSRLSTLGYGMTRIEGTGSFSGSVSIIFMIVPRKELSRLLSIISREYPDLLYTIEDVRNIKDGARIFYQDPKRRILSFFGM
Gene Information The gene name is Mboo_0605, and the expression region spans the full length of the protein .
predicted molecular weight: Information about the molecular weight of the protein is unavailable.
KEGG: mbn:Mboo_0605
STRING: 456442.Mboo_0605
Methanoregula boonei is an acidophilic methanogen that has evolved unique adaptations to survive in acidic, nutrient-poor environments such as peat bogs. Its genome reveals distinctive features that facilitate survival under these challenging conditions, including the ability to generate ATP using protons (which are abundant in acidic peat) rather than sodium ions (which are scarce) . This archaeon also demonstrates redundancy in potassium uptake genes (trk, kdp), likely reflecting adaptation to the hypokalemic status of many peat bogs .
For protein research, M. boonei represents an excellent model organism for studying how proteins adapt to function in acidic conditions. Its proteins, including Mboo_0605, may possess unique structural and functional characteristics that provide insights into acid-stable protein engineering and archaea-specific biological processes.
For recombinant production of archaeal proteins like Mboo_0605, Escherichia coli BL21(DE3) remains the most widely used expression system due to its simplicity and high yield potential . The key methodological steps include:
Molecular assembly of the expression construct with appropriate tags (e.g., 6×His, fluorescent proteins like EGFP or mCherry)
Transformation into E. coli BL21(DE3) cells
Optimization of expression conditions (temperature, IPTG concentration, duration)
Purification using immobilized metal affinity chromatography (IMAC) with a Ni-NTA column
Codon optimization of the gene sequence for E. coli
Use of specialized E. coli strains (e.g., Rosetta for rare codons)
Testing multiple fusion tags beyond 6×His, such as MBP or SUMO
Lower expression temperatures (16-25°C) to improve folding
When designing experiments with recombinant M. boonei proteins like Mboo_0605, researchers should employ structured experimental approaches that prioritize clear variable definition and proper controls . Key considerations include:
Variable identification and control:
Independent variables: Expression conditions, buffer composition, pH, temperature
Dependent variables: Protein yield, purity, activity, stability
Extraneous variables: Batch-to-batch variations, equipment calibration
Control groups and experimental groups:
Use proper control groups (non-induced cultures, empty vector controls) alongside experimental groups
Validation strategies:
Verify protein identity through multiple methods (SDS-PAGE, western blotting, mass spectrometry)
Include appropriate positive controls in activity assays
Implement technical and biological replicates to ensure statistical validity
Data reporting:
Document complete experimental metadata following best practices for transparency
Structure results tables to facilitate assessment of both internal and external validity
Based on protocols for recombinant protein production, the following step-by-step approach is recommended for Mboo_0605:
Expression protocol:
Transform the expression construct containing Mboo_0605 with appropriate tags (6×His, TAT-HA, EGFP/mCherry) into E. coli BL21(DE3)
Grow transformed cells in LB medium with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8
Induce protein expression with IPTG (typically 0.1-1.0 mM) and continue growth at lower temperature (16-25°C) for 16-18 hours
Harvest cells by centrifugation and store pellet at -80°C or proceed directly to purification
Purification protocol:
Resuspend cell pellet in lysis buffer containing protease inhibitors
Lyse cells using sonication or mechanical disruption
Clarify lysate by centrifugation (20,000 × g, 30 min, 4°C)
Perform IMAC purification using Ni-NTA resin:
Perform size exclusion chromatography to improve purity and remove aggregates
Verify purity by SDS-PAGE and western blotting
Buffer considerations for acidophilic proteins:
Consider testing buffers across a pH range (pH 4.0-7.5) to identify optimal stability conditions
Include stabilizing agents like glycerol (10-20%) or specific ions based on M. boonei's natural environment
Several challenges may arise during purification of recombinant Mboo_0605, particularly due to its archaeal origin. The following table outlines common issues and recommended solutions:
Rigorous quality control is essential for ensuring the reliability of research involving recombinant Mboo_0605. A comprehensive QC workflow should include:
Identity verification:
SDS-PAGE to confirm expected molecular weight
Western blotting with anti-His antibodies or other tag-specific antibodies
Mass spectrometry for accurate mass determination and peptide mapping
Purity assessment:
Densitometric analysis of SDS-PAGE bands (aim for >95% purity)
Size exclusion chromatography to detect aggregates or contaminants
Endotoxin testing if the protein will be used in cell-based assays
Structural integrity:
Circular dichroism spectroscopy to assess secondary structure content
Fluorescence spectroscopy to evaluate tertiary structure
Dynamic light scattering to assess homogeneity and detect aggregation
Functional validation:
Activity assays based on predicted function (if known)
Thermal shift assays to assess proper folding and stability
Binding assays with predicted interaction partners
Storage stability:
Accelerated stability studies under various conditions
Activity retention after freeze-thaw cycles
Long-term storage tests at different temperatures (-80°C, -20°C, 4°C)
Determining the function of uncharacterized proteins like Mboo_0605 requires an integrated approach combining multiple experimental and computational strategies:
Computational function prediction:
Sequence-based analysis:
PSI-BLAST and HHpred for remote homology detection
Motif scanning using PROSITE, PFAM, and InterPro
Genomic context analysis (neighboring genes often have related functions)
Structure-based prediction:
Homology modeling to predict 3D structure
Structural comparison with functionally characterized proteins
Active site prediction and analysis
Experimental function determination:
Biochemical approaches:
Substrate screening against libraries of potential substrates
Activity-based protein profiling with activity-specific probes
Metabolite profiling in cells expressing or lacking the protein
Interaction studies:
Pull-down assays coupled with mass spectrometry
Yeast two-hybrid or bacterial two-hybrid screening
Protein microarray analysis
Cellular localization:
Phenotypic analysis:
Expression in heterologous systems and phenotype observation
Gene knockout/knockdown if genetic tools are available for M. boonei
Complementation studies in model organisms
The adaptations of M. boonei to acidic, nutrient-poor environments provide valuable context for functional studies of Mboo_0605:
pH-related considerations:
M. boonei generates ATP using abundant protons rather than scarce sodium ions in its natural acidic environment
Functional assays should include pH ranges relevant to M. boonei's natural habitat (pH 4.0-5.5)
Comparative activity analysis at different pH values may reveal pH-dependent functions
Nutrient acquisition relevance:
Given M. boonei's adaptation to nutrient-poor environments, Mboo_0605 may be involved in:
Efficient nutrient scavenging mechanisms
Alternative metabolic pathways that require fewer cofactors
Stress response systems for nutrient limitation
Energy metabolism connections:
The modified membrane-bound methyltransferase system in M. boonei suggests potential involvement of UPF0316 family proteins in:
Energy conservation systems
Alternative electron transport mechanisms
Methanogenesis under acidic conditions
Experimental approach:
Test enzyme activity across pH range of 4.0-7.5
Examine stability and structure at different pH values
Investigate potential roles in methanogenesis pathways
Assess interactions with known components of energy metabolism systems
Structural characterization of Mboo_0605 would provide valuable insights into its function. The following techniques are recommended, along with their specific applications:
X-ray crystallography:
Provides atomic-level resolution of protein structure
Requires successfully growing protein crystals that diffract well
Optimization strategies include:
Screening diverse crystallization conditions
Testing various constructs with different boundaries
Employing surface entropy reduction mutations
Co-crystallization with potential ligands or binding partners
Cryo-electron microscopy (cryo-EM):
Particularly useful if Mboo_0605 forms larger complexes
Does not require crystallization, which can be challenging for some proteins
Single-particle analysis workflow:
Optimize sample preparation (concentration, buffer, grid type)
Collect high-quality micrographs
Process data using standard software packages
Generate 3D reconstructions at highest possible resolution
Nuclear magnetic resonance (NMR) spectroscopy:
Ideal for smaller proteins or domains (<30 kDa)
Provides information on protein dynamics and conformational states
Useful for mapping binding interfaces
Requires isotope labeling (15N, 13C) of the recombinant protein
Small-angle X-ray scattering (SAXS):
Hydrogen-deuterium exchange mass spectrometry (HDX-MS):
Maps solvent accessibility and conformational dynamics
Useful for identifying binding interfaces and allosteric changes
Does not require large amounts of protein or high purity
Can be performed under various conditions to assess pH-dependent structural changes
Molecular dynamics (MD) simulations offer powerful computational approaches to study Mboo_0605 dynamics and function:
Applications of MD simulations:
Structural stability analysis:
Assess stability of the protein under different pH conditions
Identify flexible regions and conformational changes
Evaluate the impact of point mutations on structure
Ligand binding studies:
Predict binding sites and binding modes of potential ligands
Calculate binding free energies
Identify key residues involved in recognition and binding
pH-dependent behavior:
Simulate protein behavior at different protonation states
Assess the impact of acidic environments on protein structure
Model the influence of pH on functional mechanisms
Protein-protein interaction analysis:
Predict interaction interfaces with potential binding partners
Calculate stability of protein complexes
Identify key residues mediating protein-protein interactions
Methodological workflow:
Obtain structural model (from experimental structures or homology modeling)
Prepare system (add water, ions, define protonation states)
Perform energy minimization and equilibration
Run production simulations (typically 100ns-1μs)
Analyze trajectories for structural parameters, energetics, and dynamics
Validate computational predictions with experimental data
Protein engineering can optimize Mboo_0605 for various research applications:
Stability engineering:
Introduction of disulfide bonds to enhance thermostability
Surface charge optimization for stability at desired pH
Consensus-based mutations from related UPF0316 family proteins
Computational design of stabilizing mutations
Solubility enhancement:
Surface hydrophobic residue replacement
Introduction of charged residues at strategic positions
Creation of optimized solubility tags
Reduction of aggregation-prone regions
Functional engineering:
Site-directed mutagenesis of predicted active site residues
Creation of constitutively active variants
Engineering of allosteric regulation
Domain swapping with related proteins
Detection and purification optimization:
Strategic placement of affinity tags for minimal functional interference
Introduction of specific protease cleavage sites
Split protein complementation systems for interaction studies
Introduction of chemical handles for bioconjugation
Experimental approach:
Design multiple variants based on structural and sequence analysis
Express and purify variant proteins using the protocol outlined in section 2.1
Screen variants for desired properties (stability, solubility, activity)
Characterize promising candidates using methods from section 3.3
Iterate design process based on experimental results
Systems biology provides frameworks to understand Mboo_0605's role within the broader cellular context:
Metabolic network analysis:
Integrate Mboo_0605 into genome-scale metabolic models of M. boonei
Perform flux balance analysis to predict phenotypic effects of gene deletion/overexpression
Identify potential metabolic pathways involving Mboo_0605
Simulate growth under various environmental conditions
Protein-protein interaction networks:
Construct interaction networks based on experimental data
Predict additional interactions using homology-based approaches
Identify potential functional modules containing Mboo_0605
Map interactions to biological processes
Transcriptional regulation:
Analyze promoter regions for transcription factor binding sites
Identify co-expressed genes under various conditions
Construct regulatory networks including Mboo_0605
Model dynamic responses to environmental changes
Multi-omics integration:
Combine proteomics, transcriptomics, and metabolomics data
Correlate Mboo_0605 abundance with metabolic states
Identify condition-specific regulation patterns
Develop predictive models of cellular behavior
Experimental validation approach:
Generate testable hypotheses from systems models
Design targeted experiments to validate predictions
Refine models based on experimental results
Iterate between computational prediction and experimental validation
Low expression is a common challenge when working with archaeal proteins like Mboo_0605. The following systematic troubleshooting approach is recommended:
Diagnostic steps:
Verify plasmid integrity through sequencing
Confirm transformation efficiency
Test expression at small scale with multiple conditions
Analyze both soluble and insoluble fractions
Expression optimization strategies:
| Issue | Optimization Strategy | Implementation Details |
|---|---|---|
| Codon bias | Codon optimization | - Synthesize gene with E. coli-optimized codons - Use Rosetta or other strains supplying rare tRNAs - Identify and modify problematic codon clusters |
| Toxicity | Expression control | - Use tightly regulated promoters (T7lac, araBAD) - Reduce basal expression with glucose supplementation - Transfer to expression vectors with lower copy numbers |
| Protein instability | Stabilization approaches | - Add protease inhibitors during extraction - Co-express with chaperones (GroEL/ES, DnaK) - Reduce cultivation temperature (16-25°C) - Test different fusion partners (MBP, SUMO, GST) |
| Media limitations | Media optimization | - Test enriched media formulations (TB, 2YT) - Supplement with trace elements - Use auto-induction media for gradual induction |
| Induction conditions | Induction optimization | - Test various IPTG concentrations (0.1-1.0 mM) - Induce at different growth phases (OD600 0.4-1.0) - Extend expression time (overnight at lower temperatures) |
Advanced alternatives:
Test alternative expression hosts (C41/C43 for toxic proteins)
Consider cell-free protein synthesis systems
Explore archaeal expression hosts for challenging proteins
Investigate expression as inclusion bodies followed by refolding
Protein misfolding and aggregation represent significant challenges when working with recombinant archaeal proteins:
Diagnostic indicators of misfolding/aggregation:
Protein appears in insoluble fraction during cell lysis
Visible precipitation during purification steps
Elution in void volume during size exclusion chromatography
Abnormal migration on native PAGE
Poor reproducibility of functional assays
Prevention and resolution strategies:
Expression conditions modification:
Reduce expression temperature (16-20°C)
Decrease inducer concentration
Co-express with molecular chaperones
Add chemical chaperones to culture media (glycerol, betaine)
Buffer optimization:
Purification approach modification:
Use gentler lysis methods (freeze-thaw, mild detergents)
Perform purification at 4°C
Include detergents (0.05-0.1% Triton X-100, Tween-20)
Consider on-column refolding protocols
Refolding from inclusion bodies:
Solubilize inclusion bodies (8M urea or 6M guanidine HCl)
Remove denaturant by dialysis or dilution
Test various refolding buffers with redox pairs
Use artificial chaperones (cyclodextrin)
Construct redesign:
Remove flexible termini based on secondary structure prediction
Create stable domain constructs
Test alternative fusion tags
Introduce stabilizing mutations based on homology models
Developing robust functional assays for an uncharacterized protein like Mboo_0605 requires systematic optimization:
General optimization principles:
Begin with broad-spectrum activity assays based on predicted function
Narrow down conditions based on initial results
Optimize one parameter at a time while keeping others constant
Include appropriate positive and negative controls
Ensure reproducibility through multiple independent experiments
Key parameters for optimization:
Assay development strategy:
Start with established assays for related proteins if known
Design assays based on predicted biochemical function
Include controls for non-specific activity
Validate with known inhibitors or substrate analogs if available
Optimize detection sensitivity and specificity
Ensure linearity with respect to time and protein concentration
When preparing to publish research on Mboo_0605, researchers should adhere to best practices for reproducibility and transparency:
Methods reporting:
Provide complete details of expression construct design
Include comprehensive protocols for protein production and purification
Describe all experimental conditions in sufficient detail for reproduction
Follow guidelines for creating informative tables that allow assessment of internal and external validity
Data presentation:
Present representative data alongside statistical analyses
Include appropriate controls for all experiments
Provide raw data through repositories when possible
Validation and reproducibility:
Demonstrate reproducibility across multiple protein preparations
Validate key findings using orthogonal methods
Address potential limitations and alternative interpretations
Contextual interpretation:
Relate findings to the biology of M. boonei and its unique adaptations
Compare results with those from related proteins in other organisms
Discuss implications for understanding archaeal biology
Suggest future research directions based on findings
Initial characterization of Mboo_0605 can open multiple avenues for future research:
Structural biology expansion:
Determine high-resolution structures in different functional states
Investigate pH-dependent structural changes
Study complexes with identified interaction partners
Perform dynamics studies across various conditions
Functional investigations:
Develop genetic tools for M. boonei to study the protein in its native context
Investigate the role of Mboo_0605 in M. boonei's adaptation to acidic environments
Explore potential applications based on identified functions
Study homologs across other archaeal species
Biotechnological applications:
Engineer enhanced variants with improved stability or activity
Explore potential industrial applications based on unique properties
Develop biosensors or biocatalysts if appropriate activities are identified
Investigate medical applications if relevant interactions are discovered
Systems biology integration:
Incorporate Mboo_0605 function into genome-scale models
Study regulation of Mboo_0605 expression under different conditions
Investigate its role in response to environmental stresses
Explore evolutionary aspects across the Archaea domain