Recombinant Methanoregula boonei UPF0316 protein Mboo_0605 (Mboo_0605)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Methanoregula boonei UPF0316 protein Mboo_0605 (Mboo_0605) is a protein derived from the archaeon Methanoregula boonei . Methanoregula boonei is an acidophilic, hydrogenotrophic methanogen, meaning it thrives in acidic environments and produces methane from hydrogen and carbon dioxide . The protein is designated as UPF0316, which stands for "Unknown Protein Function 0316," indicating that its specific function is not yet fully understood .

Organism: Methanoregula boonei

Methanoregula boonei is a novel species of methanogenic archaea first isolated from an acidic bog near Ithaca, NY . This organism exhibits unique adaptations that allow it to survive in acidic, nutrient-poor conditions .

  • Morphology Methanoregula boonei exhibits a dimorphic morphology, displaying both thin rods (0.2-0.3 μm in diameter and 0.8-3.0 μm long) and irregular cocci (0.2-0.8 μm in diameter) .

  • Metabolism The archaeon utilizes H2/CO2 to produce methane but cannot use formate, acetate, methanol, ethanol, 2-propanol, butanol, or trimethylamine .

  • Growth Conditions Optimal growth occurs near pH 5.1 and 35 °C. It can grow in basal medium with low sodium concentrations (0.43 mM Na+), and its growth is inhibited by 50 mM NaCl .

Mboo_0605 Characteristics

Mboo_0605 is an UPF0316 protein from Methanoregula boonei strain 6A8 . The protein's function is currently unknown, but its sequence and genetic context may provide clues .

  • Sequence Information The protein consists of 190 amino acids .

  • AA Sequence MDIGTFWSVAAIPLLILVARIAEASLESVRTIYISKGHANLAAYVGIVKTGIWLISTGLVLTDLMQFWNLFAYLAGYGMGTVLGMEIENLISIGYVIVRLITPSDPQALMSRLSTLGYGMTRIEGTGSFSGSVSIIFMIVPRKELSRLLSIISREYPDLLYTIEDVRNIKDGARIFYQDPKRRILSFFGM

  • Gene Information The gene name is Mboo_0605, and the expression region spans the full length of the protein .

  • predicted molecular weight: Information about the molecular weight of the protein is unavailable.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. To request a specific tag, please indicate this in your order; we will prioritize fulfilling such requests.
Synonyms
Mboo_0605; UPF0316 protein Mboo_0605
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8)
Target Names
Mboo_0605
Target Protein Sequence
MDIGTFWSVAAIPLLILVARIAEASLESVRTIYISKGHANLAAYVGIVKTGIWLISTGLV LTDLMQFWNLFAYLAGYGMGTVLGMEIENLISIGYVIVRLITPSDPQALMSRLSTLGYGM TRIEGTGSFSGSVSIIFMIVPRKELSRLLSIISREYPDLLYTIEDVRNIKDGARIFYQDP KRRILSFFGM
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanoregula boonei and why is it significant for protein research?

Methanoregula boonei is an acidophilic methanogen that has evolved unique adaptations to survive in acidic, nutrient-poor environments such as peat bogs. Its genome reveals distinctive features that facilitate survival under these challenging conditions, including the ability to generate ATP using protons (which are abundant in acidic peat) rather than sodium ions (which are scarce) . This archaeon also demonstrates redundancy in potassium uptake genes (trk, kdp), likely reflecting adaptation to the hypokalemic status of many peat bogs .

For protein research, M. boonei represents an excellent model organism for studying how proteins adapt to function in acidic conditions. Its proteins, including Mboo_0605, may possess unique structural and functional characteristics that provide insights into acid-stable protein engineering and archaea-specific biological processes.

What expression systems are recommended for recombinant production of archaeal proteins like Mboo_0605?

For recombinant production of archaeal proteins like Mboo_0605, Escherichia coli BL21(DE3) remains the most widely used expression system due to its simplicity and high yield potential . The key methodological steps include:

  • Molecular assembly of the expression construct with appropriate tags (e.g., 6×His, fluorescent proteins like EGFP or mCherry)

  • Transformation into E. coli BL21(DE3) cells

  • Optimization of expression conditions (temperature, IPTG concentration, duration)

  • Purification using immobilized metal affinity chromatography (IMAC) with a Ni-NTA column

  • Codon optimization of the gene sequence for E. coli

  • Use of specialized E. coli strains (e.g., Rosetta for rare codons)

  • Testing multiple fusion tags beyond 6×His, such as MBP or SUMO

  • Lower expression temperatures (16-25°C) to improve folding

What are the key experimental design considerations when working with recombinant M. boonei proteins?

When designing experiments with recombinant M. boonei proteins like Mboo_0605, researchers should employ structured experimental approaches that prioritize clear variable definition and proper controls . Key considerations include:

Variable identification and control:

  • Independent variables: Expression conditions, buffer composition, pH, temperature

  • Dependent variables: Protein yield, purity, activity, stability

  • Extraneous variables: Batch-to-batch variations, equipment calibration

Control groups and experimental groups:

  • Use proper control groups (non-induced cultures, empty vector controls) alongside experimental groups

  • Implement random distribution of samples to minimize bias

Validation strategies:

  • Verify protein identity through multiple methods (SDS-PAGE, western blotting, mass spectrometry)

  • Include appropriate positive controls in activity assays

  • Implement technical and biological replicates to ensure statistical validity

Data reporting:

  • Document complete experimental metadata following best practices for transparency

  • Structure results tables to facilitate assessment of both internal and external validity

What is the optimal protocol for expression and purification of recombinant Mboo_0605?

Based on protocols for recombinant protein production, the following step-by-step approach is recommended for Mboo_0605:

Expression protocol:

  • Transform the expression construct containing Mboo_0605 with appropriate tags (6×His, TAT-HA, EGFP/mCherry) into E. coli BL21(DE3)

  • Grow transformed cells in LB medium with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8

  • Induce protein expression with IPTG (typically 0.1-1.0 mM) and continue growth at lower temperature (16-25°C) for 16-18 hours

  • Harvest cells by centrifugation and store pellet at -80°C or proceed directly to purification

Purification protocol:

  • Resuspend cell pellet in lysis buffer containing protease inhibitors

  • Lyse cells using sonication or mechanical disruption

  • Clarify lysate by centrifugation (20,000 × g, 30 min, 4°C)

  • Perform IMAC purification using Ni-NTA resin:

    • Load clarified lysate onto equilibrated column

    • Wash with increasing imidazole concentrations

    • Elute protein with high imidazole buffer (250-500 mM)

  • Perform size exclusion chromatography to improve purity and remove aggregates

  • Verify purity by SDS-PAGE and western blotting

Buffer considerations for acidophilic proteins:

  • Consider testing buffers across a pH range (pH 4.0-7.5) to identify optimal stability conditions

  • Include stabilizing agents like glycerol (10-20%) or specific ions based on M. boonei's natural environment

How can I address common challenges in the purification of recombinant Mboo_0605?

Several challenges may arise during purification of recombinant Mboo_0605, particularly due to its archaeal origin. The following table outlines common issues and recommended solutions:

ChallengePotential CausesMethodological Solutions
Low expression yieldCodon bias, toxicity, protein instability- Optimize codon usage for E. coli
- Use tightly regulated promoters
- Co-express with chaperones
- Test multiple E. coli strains
Poor solubilityImproper folding, hydrophobic regions, incorrect disulfide bonds- Reduce induction temperature (16-20°C)
- Add solubility-enhancing tags (MBP, SUMO)
- Include stabilizing agents in buffers
- Consider cell-free expression systems
Protein aggregationImproper folding, exposure of hydrophobic residues- Optimize buffer conditions (pH, salt, additives)
- Include reducing agents if cysteines are present
- Add detergents for membrane-associated proteins
- Use gradient elution during chromatography
Low purityNon-specific binding to resin, protein degradation- Optimize imidazole concentration in wash buffers
- Include additional purification steps (ion exchange, SEC)
- Add protease inhibitors throughout purification
- Work at 4°C to minimize degradation
Loss of activityDenaturation during purification, cofactor loss- Test activity throughout purification process
- Supplement buffers with potential cofactors
- Optimize pH based on M. boonei's acidophilic nature
- Minimize freeze-thaw cycles

What quality control measures should be implemented for recombinant Mboo_0605 preparations?

Rigorous quality control is essential for ensuring the reliability of research involving recombinant Mboo_0605. A comprehensive QC workflow should include:

Identity verification:

  • SDS-PAGE to confirm expected molecular weight

  • Western blotting with anti-His antibodies or other tag-specific antibodies

  • Mass spectrometry for accurate mass determination and peptide mapping

Purity assessment:

  • Densitometric analysis of SDS-PAGE bands (aim for >95% purity)

  • Size exclusion chromatography to detect aggregates or contaminants

  • Endotoxin testing if the protein will be used in cell-based assays

Structural integrity:

  • Circular dichroism spectroscopy to assess secondary structure content

  • Fluorescence spectroscopy to evaluate tertiary structure

  • Dynamic light scattering to assess homogeneity and detect aggregation

Functional validation:

  • Activity assays based on predicted function (if known)

  • Thermal shift assays to assess proper folding and stability

  • Binding assays with predicted interaction partners

Storage stability:

  • Accelerated stability studies under various conditions

  • Activity retention after freeze-thaw cycles

  • Long-term storage tests at different temperatures (-80°C, -20°C, 4°C)

What approaches can be used to determine the function of an uncharacterized protein like Mboo_0605?

Determining the function of uncharacterized proteins like Mboo_0605 requires an integrated approach combining multiple experimental and computational strategies:

Computational function prediction:

  • Sequence-based analysis:

    • PSI-BLAST and HHpred for remote homology detection

    • Motif scanning using PROSITE, PFAM, and InterPro

    • Genomic context analysis (neighboring genes often have related functions)

  • Structure-based prediction:

    • Homology modeling to predict 3D structure

    • Structural comparison with functionally characterized proteins

    • Active site prediction and analysis

Experimental function determination:

  • Biochemical approaches:

    • Substrate screening against libraries of potential substrates

    • Activity-based protein profiling with activity-specific probes

    • Metabolite profiling in cells expressing or lacking the protein

  • Interaction studies:

    • Pull-down assays coupled with mass spectrometry

    • Yeast two-hybrid or bacterial two-hybrid screening

    • Protein microarray analysis

  • Cellular localization:

    • Fluorescence microscopy using the EGFP/mCherry fusion protein

    • Subcellular fractionation followed by western blotting

    • Immunogold electron microscopy if antibodies are available

  • Phenotypic analysis:

    • Expression in heterologous systems and phenotype observation

    • Gene knockout/knockdown if genetic tools are available for M. boonei

    • Complementation studies in model organisms

How can the unique adaptations of M. boonei inform functional studies of Mboo_0605?

The adaptations of M. boonei to acidic, nutrient-poor environments provide valuable context for functional studies of Mboo_0605:

pH-related considerations:

  • M. boonei generates ATP using abundant protons rather than scarce sodium ions in its natural acidic environment

  • Functional assays should include pH ranges relevant to M. boonei's natural habitat (pH 4.0-5.5)

  • Comparative activity analysis at different pH values may reveal pH-dependent functions

Nutrient acquisition relevance:

  • Given M. boonei's adaptation to nutrient-poor environments, Mboo_0605 may be involved in:

    • Efficient nutrient scavenging mechanisms

    • Alternative metabolic pathways that require fewer cofactors

    • Stress response systems for nutrient limitation

Energy metabolism connections:

  • The modified membrane-bound methyltransferase system in M. boonei suggests potential involvement of UPF0316 family proteins in:

    • Energy conservation systems

    • Alternative electron transport mechanisms

    • Methanogenesis under acidic conditions

Experimental approach:

  • Test enzyme activity across pH range of 4.0-7.5

  • Examine stability and structure at different pH values

  • Investigate potential roles in methanogenesis pathways

  • Assess interactions with known components of energy metabolism systems

What advanced structural biology techniques are most suitable for Mboo_0605 characterization?

Structural characterization of Mboo_0605 would provide valuable insights into its function. The following techniques are recommended, along with their specific applications:

X-ray crystallography:

  • Provides atomic-level resolution of protein structure

  • Requires successfully growing protein crystals that diffract well

  • Optimization strategies include:

    • Screening diverse crystallization conditions

    • Testing various constructs with different boundaries

    • Employing surface entropy reduction mutations

    • Co-crystallization with potential ligands or binding partners

Cryo-electron microscopy (cryo-EM):

  • Particularly useful if Mboo_0605 forms larger complexes

  • Does not require crystallization, which can be challenging for some proteins

  • Single-particle analysis workflow:

    • Optimize sample preparation (concentration, buffer, grid type)

    • Collect high-quality micrographs

    • Process data using standard software packages

    • Generate 3D reconstructions at highest possible resolution

Nuclear magnetic resonance (NMR) spectroscopy:

  • Ideal for smaller proteins or domains (<30 kDa)

  • Provides information on protein dynamics and conformational states

  • Useful for mapping binding interfaces

  • Requires isotope labeling (15N, 13C) of the recombinant protein

Small-angle X-ray scattering (SAXS):

Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Maps solvent accessibility and conformational dynamics

  • Useful for identifying binding interfaces and allosteric changes

  • Does not require large amounts of protein or high purity

  • Can be performed under various conditions to assess pH-dependent structural changes

How can molecular dynamics simulations complement experimental studies of Mboo_0605?

Molecular dynamics (MD) simulations offer powerful computational approaches to study Mboo_0605 dynamics and function:

Applications of MD simulations:

  • Structural stability analysis:

    • Assess stability of the protein under different pH conditions

    • Identify flexible regions and conformational changes

    • Evaluate the impact of point mutations on structure

  • Ligand binding studies:

    • Predict binding sites and binding modes of potential ligands

    • Calculate binding free energies

    • Identify key residues involved in recognition and binding

  • pH-dependent behavior:

    • Simulate protein behavior at different protonation states

    • Assess the impact of acidic environments on protein structure

    • Model the influence of pH on functional mechanisms

  • Protein-protein interaction analysis:

    • Predict interaction interfaces with potential binding partners

    • Calculate stability of protein complexes

    • Identify key residues mediating protein-protein interactions

Methodological workflow:

  • Obtain structural model (from experimental structures or homology modeling)

  • Prepare system (add water, ions, define protonation states)

  • Perform energy minimization and equilibration

  • Run production simulations (typically 100ns-1μs)

  • Analyze trajectories for structural parameters, energetics, and dynamics

  • Validate computational predictions with experimental data

What protein engineering strategies could enhance the utility of Mboo_0605 for research applications?

Protein engineering can optimize Mboo_0605 for various research applications:

Stability engineering:

  • Introduction of disulfide bonds to enhance thermostability

  • Surface charge optimization for stability at desired pH

  • Consensus-based mutations from related UPF0316 family proteins

  • Computational design of stabilizing mutations

Solubility enhancement:

  • Surface hydrophobic residue replacement

  • Introduction of charged residues at strategic positions

  • Creation of optimized solubility tags

  • Reduction of aggregation-prone regions

Functional engineering:

  • Site-directed mutagenesis of predicted active site residues

  • Creation of constitutively active variants

  • Engineering of allosteric regulation

  • Domain swapping with related proteins

Detection and purification optimization:

  • Strategic placement of affinity tags for minimal functional interference

  • Introduction of specific protease cleavage sites

  • Split protein complementation systems for interaction studies

  • Introduction of chemical handles for bioconjugation

Experimental approach:

  • Design multiple variants based on structural and sequence analysis

  • Express and purify variant proteins using the protocol outlined in section 2.1

  • Screen variants for desired properties (stability, solubility, activity)

  • Characterize promising candidates using methods from section 3.3

  • Iterate design process based on experimental results

How can systems biology approaches integrate Mboo_0605 into the broader metabolic context of M. boonei?

Systems biology provides frameworks to understand Mboo_0605's role within the broader cellular context:

Metabolic network analysis:

  • Integrate Mboo_0605 into genome-scale metabolic models of M. boonei

  • Perform flux balance analysis to predict phenotypic effects of gene deletion/overexpression

  • Identify potential metabolic pathways involving Mboo_0605

  • Simulate growth under various environmental conditions

Protein-protein interaction networks:

  • Construct interaction networks based on experimental data

  • Predict additional interactions using homology-based approaches

  • Identify potential functional modules containing Mboo_0605

  • Map interactions to biological processes

Transcriptional regulation:

  • Analyze promoter regions for transcription factor binding sites

  • Identify co-expressed genes under various conditions

  • Construct regulatory networks including Mboo_0605

  • Model dynamic responses to environmental changes

Multi-omics integration:

  • Combine proteomics, transcriptomics, and metabolomics data

  • Correlate Mboo_0605 abundance with metabolic states

  • Identify condition-specific regulation patterns

  • Develop predictive models of cellular behavior

Experimental validation approach:

  • Generate testable hypotheses from systems models

  • Design targeted experiments to validate predictions

  • Refine models based on experimental results

  • Iterate between computational prediction and experimental validation

How can I resolve issues with low expression levels of recombinant Mboo_0605?

Low expression is a common challenge when working with archaeal proteins like Mboo_0605. The following systematic troubleshooting approach is recommended:

Diagnostic steps:

  • Verify plasmid integrity through sequencing

  • Confirm transformation efficiency

  • Test expression at small scale with multiple conditions

  • Analyze both soluble and insoluble fractions

Expression optimization strategies:

IssueOptimization StrategyImplementation Details
Codon biasCodon optimization- Synthesize gene with E. coli-optimized codons
- Use Rosetta or other strains supplying rare tRNAs
- Identify and modify problematic codon clusters
ToxicityExpression control- Use tightly regulated promoters (T7lac, araBAD)
- Reduce basal expression with glucose supplementation
- Transfer to expression vectors with lower copy numbers
Protein instabilityStabilization approaches- Add protease inhibitors during extraction
- Co-express with chaperones (GroEL/ES, DnaK)
- Reduce cultivation temperature (16-25°C)
- Test different fusion partners (MBP, SUMO, GST)
Media limitationsMedia optimization- Test enriched media formulations (TB, 2YT)
- Supplement with trace elements
- Use auto-induction media for gradual induction
Induction conditionsInduction optimization- Test various IPTG concentrations (0.1-1.0 mM)
- Induce at different growth phases (OD600 0.4-1.0)
- Extend expression time (overnight at lower temperatures)

Advanced alternatives:

  • Test alternative expression hosts (C41/C43 for toxic proteins)

  • Consider cell-free protein synthesis systems

  • Explore archaeal expression hosts for challenging proteins

  • Investigate expression as inclusion bodies followed by refolding

What strategies can address protein misfolding and aggregation of recombinant Mboo_0605?

Protein misfolding and aggregation represent significant challenges when working with recombinant archaeal proteins:

Diagnostic indicators of misfolding/aggregation:

  • Protein appears in insoluble fraction during cell lysis

  • Visible precipitation during purification steps

  • Elution in void volume during size exclusion chromatography

  • Abnormal migration on native PAGE

  • Poor reproducibility of functional assays

Prevention and resolution strategies:

  • Expression conditions modification:

    • Reduce expression temperature (16-20°C)

    • Decrease inducer concentration

    • Co-express with molecular chaperones

    • Add chemical chaperones to culture media (glycerol, betaine)

  • Buffer optimization:

    • Screen buffers with varying pH (4.0-8.0) given M. boonei's acidophilic nature

    • Test different salt concentrations (100-500 mM)

    • Include stabilizing additives (glycerol, arginine, trehalose)

    • Add reducing agents if protein contains cysteines

  • Purification approach modification:

    • Use gentler lysis methods (freeze-thaw, mild detergents)

    • Perform purification at 4°C

    • Include detergents (0.05-0.1% Triton X-100, Tween-20)

    • Consider on-column refolding protocols

  • Refolding from inclusion bodies:

    • Solubilize inclusion bodies (8M urea or 6M guanidine HCl)

    • Remove denaturant by dialysis or dilution

    • Test various refolding buffers with redox pairs

    • Use artificial chaperones (cyclodextrin)

  • Construct redesign:

    • Remove flexible termini based on secondary structure prediction

    • Create stable domain constructs

    • Test alternative fusion tags

    • Introduce stabilizing mutations based on homology models

How can I optimize experimental conditions for functional assays with Mboo_0605?

Developing robust functional assays for an uncharacterized protein like Mboo_0605 requires systematic optimization:

General optimization principles:

  • Begin with broad-spectrum activity assays based on predicted function

  • Narrow down conditions based on initial results

  • Optimize one parameter at a time while keeping others constant

  • Include appropriate positive and negative controls

  • Ensure reproducibility through multiple independent experiments

Key parameters for optimization:

ParameterOptimization RangeConsiderations for M. boonei Proteins
pH4.0-8.0Test narrower ranges around pH 4.0-5.5 based on M. boonei's acidophilic nature
Temperature20-70°CInclude 37°C (optimal for E. coli) and 30-40°C (likely optimal for M. boonei)
Buffer compositionVarious buffers with overlapping pH rangesFor acidic pH: acetate, citrate, succinate buffers
For neutral pH: phosphate, HEPES, Tris buffers
Salt concentration0-500 mM NaCl or KClConsider K+ preference based on M. boonei's potassium uptake adaptations
Divalent cations0-10 mM Mg²⁺, Mn²⁺, Ca²⁺, Zn²⁺Test individually and in combinations
Reducing agents0-10 mM DTT, β-ME, TCEPEssential if protein contains cysteines
Substrate concentrationBroad range based on predicted activityStart with higher concentrations and titrate down
Protein concentration0.1-100 μg/mlOptimize to ensure signal within linear range of detection
Incubation time5 min - 24 hoursInclude multiple time points to determine reaction kinetics

Assay development strategy:

  • Start with established assays for related proteins if known

  • Design assays based on predicted biochemical function

  • Include controls for non-specific activity

  • Validate with known inhibitors or substrate analogs if available

  • Optimize detection sensitivity and specificity

  • Ensure linearity with respect to time and protein concentration

What are the key considerations for publishing research on Mboo_0605?

When preparing to publish research on Mboo_0605, researchers should adhere to best practices for reproducibility and transparency:

Methods reporting:

  • Provide complete details of expression construct design

  • Include comprehensive protocols for protein production and purification

  • Describe all experimental conditions in sufficient detail for reproduction

  • Follow guidelines for creating informative tables that allow assessment of internal and external validity

Data presentation:

  • Present representative data alongside statistical analyses

  • Include appropriate controls for all experiments

  • Provide raw data through repositories when possible

  • Structure tables to show key comparisons clearly

Validation and reproducibility:

  • Demonstrate reproducibility across multiple protein preparations

  • Validate key findings using orthogonal methods

  • Address potential limitations and alternative interpretations

  • Include power calculations and details on replicate numbers

Contextual interpretation:

  • Relate findings to the biology of M. boonei and its unique adaptations

  • Compare results with those from related proteins in other organisms

  • Discuss implications for understanding archaeal biology

  • Suggest future research directions based on findings

What future research directions might build upon initial characterization of Mboo_0605?

Initial characterization of Mboo_0605 can open multiple avenues for future research:

Structural biology expansion:

  • Determine high-resolution structures in different functional states

  • Investigate pH-dependent structural changes

  • Study complexes with identified interaction partners

  • Perform dynamics studies across various conditions

Functional investigations:

  • Develop genetic tools for M. boonei to study the protein in its native context

  • Investigate the role of Mboo_0605 in M. boonei's adaptation to acidic environments

  • Explore potential applications based on identified functions

  • Study homologs across other archaeal species

Biotechnological applications:

  • Engineer enhanced variants with improved stability or activity

  • Explore potential industrial applications based on unique properties

  • Develop biosensors or biocatalysts if appropriate activities are identified

  • Investigate medical applications if relevant interactions are discovered

Systems biology integration:

  • Incorporate Mboo_0605 function into genome-scale models

  • Study regulation of Mboo_0605 expression under different conditions

  • Investigate its role in response to environmental stresses

  • Explore evolutionary aspects across the Archaea domain

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.