Recombinant Methanoregula boonei UPF0316 protein Mboo_0791 (Mboo_0791)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Mboo_0791; UPF0316 protein Mboo_0791
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8)
Target Names
Mboo_0791
Target Protein Sequence
MQFNPGPPAGFHAPPAKQKACTVTFFLFTPDILNYIVLPVLIFLAQIANVCMETLRIVFL SKGMKYLAPVIAFFEIIIWLLAIVGVLNNLSNIAYFLAYAFGFALGTYVGLVIEEKLSIG MVIMRIITTDGSGDGITEYLQQENYGTTCLDAKGARGGVKMIISLVNRDDVPRITRHIEE TNPGAFFSIEDVRYVNQGVFRPKKQNPFTGFIHTLARPRKRV
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mboo_0791 and why is it of interest to researchers?

Mboo_0791 is a UPF0316 family protein from the methanogen Methanoregula boonei, consisting of 222 amino acids. It is of particular interest because it comes from an archaeal methanogen, which represents one of the most oxygen-sensitive organism groups in laboratory culture . Studying Mboo_0791 can provide insights into methanogen-specific protein functions and potentially their role in cellular processes unique to these anaerobic archaea. Methanogens have developed specialized mechanisms to deal with oxidative stress, and understanding proteins like Mboo_0791 may reveal novel biological pathways not found in other domains of life .

What evolutionary significance does Mboo_0791 have among methanogens?

Within the methanogen lineage, proteins with similar domain architectures to those found in Methanoregula boonei are conserved across multiple orders including Methanobacteriales, Methanomicrobiales, and Methanosarcinales . Comparative analysis of Mboo_0791 homologs can reveal evolutionary adaptations specific to methane-producing archaea. The conservation of certain protein families across methanogens suggests they serve critical functions in these organisms' unique metabolism or environmental adaptation. Research approaches should include phylogenetic analysis using multiple sequence alignments and identification of conserved residues that may indicate functional importance.

How does the genomic context of Mboo_0791 inform our understanding of its function?

Analysis of genomic context provides valuable insights into potential functional relationships. In methanogens like Methanoregula boonei, examining neighboring genes can reveal if Mboo_0791 is part of an operon or functional gene cluster similar to the regulatory relationships seen with MsvR and the fpaA-rlp-rub operon in Methanothermobacter thermautotrophicus . Researchers should investigate if Mboo_0791 is divergently transcribed from genes involved in stress responses or methanogenesis, as such arrangements often indicate functional relationships. Comparative genomic approaches across multiple methanogen species can further strengthen functional predictions based on conserved gene neighborhoods.

What expression systems are most effective for recombinant Mboo_0791 production?

While E. coli is the documented expression system for recombinant His-tagged Mboo_0791 , researchers should consider several factors when selecting an expression system:

  • E. coli expression optimization: Use specialized strains like Rosetta or BL21(DE3) that address codon bias issues common in archaeal genes. Optimize expression conditions including temperature (often 16-18°C is preferable for archaeal proteins), IPTG concentration (0.1-0.5 mM), and induction time (typically extended to 16-20 hours at lower temperatures).

  • Alternative expression systems: For proteins that resist proper folding in E. coli, consider:

    • Yeast systems (P. pastoris, S. cerevisiae) that provide a eukaryotic-like environment

    • Cell-free expression systems that avoid toxicity issues

    • Archaeal host systems for authentic post-translational modifications

Expression trials should systematically assess protein solubility and yield under different conditions using small-scale cultures before scaling up .

What purification strategies work best for His-tagged Mboo_0791?

Optimal purification of His-tagged Mboo_0791 requires a multi-step approach:

  • Immobilized metal affinity chromatography (IMAC): Use Ni-NTA or Co-based resins with stepwise imidazole gradient elution. For full-length protein recovery, employ dual-tagged constructs and increase imidazole concentration at elution to distinguish full-length from truncated proteins .

  • Secondary purification: Apply size exclusion chromatography to separate monomeric protein from aggregates and remove remaining contaminants.

  • Buffer optimization: Test multiple buffers (HEPES, Tris, phosphate) at varying pH values (7.0-8.0) and salt concentrations (150-500 mM NaCl) to identify conditions that maximize stability.

  • Quality control: Assess purity by SDS-PAGE, confirm identity by western blot or mass spectrometry, and verify proper folding using circular dichroism spectroscopy .

What methods are most reliable for assessing Mboo_0791 structural integrity?

Structural integrity assessment requires multiple complementary techniques:

  • Circular dichroism (CD) spectroscopy: Provides information about secondary structure content and thermal stability. Compare spectra with predicted secondary structure based on bioinformatic analysis.

  • Differential scanning fluorimetry (DSF): Measures thermal unfolding transitions and can identify buffer conditions that enhance stability.

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): Determines oligomeric state and detects aggregation.

  • Limited proteolysis: Identifies stable domains and confirms proper folding through resistance to controlled proteolytic digestion.

  • Activity assays: When function is known, activity assays provide the most relevant indication of proper folding and structural integrity .

How can researchers investigate potential redox-sensing functions of Mboo_0791?

Given that methanogens employ redox-sensing mechanisms to respond to oxidative stress , researchers should consider these approaches for investigating Mboo_0791's potential redox functions:

  • Cysteine content analysis: Examine the number and conservation of cysteine residues in Mboo_0791, as these often form redox-sensitive disulfide bridges or coordinate metal centers in redox-sensing proteins.

  • Differential alkylation assays: Use mass spectrometry with iodoacetamide labeling under reducing and oxidizing conditions to identify redox-active cysteine residues.

  • Electrophoretic mobility shift assays (EMSAs): If DNA-binding activity is suspected, compare binding patterns using oxidized and reduced protein preparations similar to approaches used for MsvR protein .

  • Structural studies under different redox conditions: Use X-ray crystallography or NMR to determine if structural changes occur in response to different redox states.

  • In vivo reporter systems: Develop reporter gene constructs to monitor Mboo_0791 activity in response to various oxidative stressors.

What techniques are most effective for identifying interaction partners of Mboo_0791?

Uncovering the protein-protein interaction network of Mboo_0791 requires multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP): Use anti-His antibodies to pull down Mboo_0791 complexes from cell lysates, followed by mass spectrometry to identify interacting proteins. This approach was successfully used to identify protein-protein interactions in methanogen systems .

  • Bacterial/yeast two-hybrid systems: While traditional yeast two-hybrid may be challenging for archaeal proteins, bacterial two-hybrid systems can be more suitable.

  • Proximity-dependent biotin identification (BioID): Fuse Mboo_0791 to a biotin ligase to identify proximal proteins in vivo.

  • Cross-linking mass spectrometry: Use chemical cross-linkers to stabilize transient interactions before mass spectrometric analysis.

  • Surface plasmon resonance (SPR) or microscale thermophoresis (MST): Validate and quantify specific interactions with candidate partners identified through other methods.

How might Mboo_0791 be involved in oxidative stress response mechanisms in methanogens?

Given that methanogens are highly oxygen-sensitive and have developed specialized stress response mechanisms , researchers should explore Mboo_0791's potential role through:

  • Comparative transcriptomics: Analyze gene expression changes of mboo_0791 under various stress conditions (H₂O₂, O₂ exposure, redox fluctuations).

  • Gene knockout/knockdown studies: Develop genetic tools to create mboo_0791 deletion mutants and assess phenotypic changes in stress tolerance.

  • Promoter analysis: Identify potential regulatory elements in the mboo_0791 promoter region that might respond to stress-related transcription factors similar to MsvR .

  • Metabolomic profiling: Compare metabolite profiles between wild-type and mboo_0791 mutant strains under stress conditions to identify affected pathways.

  • Heterologous expression studies: Express mboo_0791 in model organisms with well-characterized stress response systems to assess its impact on oxidative stress resistance.

What computational approaches can predict the function of Mboo_0791?

Comprehensive computational analysis of Mboo_0791 should include:

  • Domain architecture analysis: Identify conserved domains using CDD, Pfam, and InterPro databases to predict functional units within the protein. The UPF0316 domain suggests an uncharacterized protein family with potentially novel functions .

  • Protein structure prediction: Apply AlphaFold2 or similar AI-based prediction tools to generate structural models, which can reveal functional sites not evident from sequence alone .

  • Structural comparison: Use DALI or PDBeFold to identify structural homologs that may have known functions despite low sequence similarity.

  • Active site prediction: Employ tools like CASTp or SiteMap to identify potential binding pockets or catalytic sites within the predicted structure.

  • Molecular dynamics simulations: Analyze conformational flexibility and potential ligand binding sites through simulation of protein dynamics in different environments.

  • Co-evolution analysis: Use methods like GREMLIN or EVcouplings to identify co-evolving residues that may indicate functional sites or protein-protein interaction interfaces.

How can site-directed mutagenesis be applied to study Mboo_0791 function?

A systematic mutagenesis approach should target:

  • Conserved residues: Identify amino acids conserved across UPF0316 family members in different methanogens, prioritizing those for mutation.

  • Predicted functional motifs: Target residues in predicted binding pockets, active sites, or protein-protein interaction interfaces.

  • Cysteine residues: Given the importance of cysteines in redox sensing in methanogen proteins like MsvR , systematically mutate cysteine residues to serine to assess their role in potential redox functions.

  • Domain-specific mutations: Create truncation constructs to assess the function of individual domains or critical regions.

  • Alanine scanning: For regions with no clear functional prediction, perform alanine scanning mutagenesis to identify functionally important residues.

Each mutant should be characterized for proper folding, stability, potential enzymatic activity, and interaction capabilities using assays described in previous sections.

What structural features distinguish UPF0316 family proteins and what implications does this have for Mboo_0791 research?

Analysis of the UPF0316 protein family reveals:

  • Conserved structural elements: Identify secondary structure elements and tertiary arrangements conserved across family members that may indicate critical functional regions.

  • Species-specific variations: Compare methanogen UPF0316 proteins with homologs from other domains of life to identify methanogen-specific adaptations.

  • Potential metal coordination sites: Given the role of metal coordination in many archaeal proteins, analyze potential metal-binding motifs.

  • Oligomerization interfaces: Predict regions involved in potential homo- or hetero-oligomerization that may be critical for function.

  • Post-translational modification sites: Identify potential sites for archaeal-specific post-translational modifications that might regulate function.

Researchers should use this structural information to design experiments that probe the unique features of Mboo_0791, potentially revealing novel functional mechanisms unique to methanogens.

What are common challenges when working with recombinant proteins from anaerobic archaea?

Researchers face several challenges when working with methanogen proteins:

  • Codon bias: Methanogens often have different codon usage patterns than E. coli, leading to poor expression. Solution: Use codon-optimized synthetic genes or expression strains with rare tRNAs .

  • Protein misfolding: Archaeal proteins may misfold in bacterial hosts due to different folding machinery. Solution: Express at lower temperatures (16-18°C), use specialized folding strains, or add chaperone-expressing plasmids .

  • Post-translational modifications: Archaeal proteins may require specific modifications absent in bacterial hosts. Solution: Consider archaeal expression systems or cell-free systems with supplemented modification enzymes.

  • Oxygen sensitivity: Many methanogen proteins are inherently oxygen-sensitive. Solution: Purify under strict anaerobic conditions using glove boxes or add reducing agents like DTT or β-mercaptoethanol to buffers .

  • Protein instability: Archaeal proteins may have evolved for different cellular environments. Solution: Screen multiple buffer conditions and additives (glycerol, arginine, trehalose) to enhance stability .

How can researchers resolve solubility issues when expressing Mboo_0791?

To overcome solubility challenges with Mboo_0791:

  • Fusion partners: Test multiple solubility-enhancing fusion partners:

    • MBP (maltose-binding protein)

    • SUMO

    • Thioredoxin

    • GST (glutathione S-transferase)

  • Expression conditions optimization: Systematically test:

    • Temperature (37°C, 30°C, 25°C, 18°C, 16°C)

    • IPTG concentration (0.01 mM to 1 mM)

    • Media composition (rich vs. minimal, supplements)

    • Co-expression with chaperones (GroEL/ES, DnaK/J, ClpB)

  • Lysis buffer optimization: Screen buffers with:

    • Various pH values (6.0-9.0)

    • Salt concentrations (100-500 mM)

    • Additives (glycerol 5-20%, arginine 50-200 mM)

    • Mild detergents (0.1-1% Triton X-100, 0.5-2% CHAPS)

  • Refolding strategies: If inclusion bodies form, develop refolding protocols using:

    • Step-wise dialysis

    • On-column refolding

    • Rapid dilution methods

  • Protein engineering: Consider creating truncated constructs that remove potentially problematic regions while retaining functional domains .

What experimental design considerations are critical for studying potential redox functions of Mboo_0791?

When investigating redox properties:

  • Buffer considerations:

    • Maintain anaerobic conditions throughout purification and analysis

    • Use degassed buffers with appropriate reducing agents

    • Consider oxygen-free glove box work for critical experiments

  • Redox state control:

    • Establish protocols to prepare consistently reduced or oxidized protein

    • Use redox buffers with defined potentials (glutathione, dithiothreitol systems)

    • Monitor redox state using specific probes or cysteine-modifying reagents

  • Functional assays:

    • Design comparative assays under different redox conditions

    • Include appropriate positive controls (known redox-sensitive proteins)

    • Consider protein-DNA interactions under different redox states as demonstrated with MsvR

  • Structural analysis:

    • Perform structural studies under defined redox conditions

    • Use techniques sensitive to conformational changes (fluorescence, CD spectroscopy)

    • Consider crosslinking studies to trap redox-dependent conformational states

  • In vivo validation:

    • Design experiments to correlate in vitro observations with in vivo function

    • Consider heterologous expression systems with controllable redox environments

    • Develop reporter systems to monitor activity under different redox conditions

How should researchers interpret contradictory functional data for Mboo_0791?

When facing contradictory results:

  • Systematic validation:

    • Repeat experiments using multiple independent methods

    • Verify protein quality and integrity for each experiment

    • Use both in vitro and in vivo approaches to cross-validate findings

  • Context dependency:

    • Consider if contradictions arise from different experimental conditions

    • Test if protein behavior changes based on redox state, pH, or temperature

    • Investigate if protein modifications affect function

  • Methodological assessment:

    • Evaluate limitations of each experimental approach

    • Consider if artificial tags or fusion partners affect results

    • Assess if expression system influences protein behavior

  • Multifunctionality:

    • Explore if Mboo_0791 has multiple distinct functions under different conditions

    • Investigate if it acts as part of different protein complexes

    • Consider condition-specific conformational changes that alter function

  • Comparative analysis:

    • Compare results with homologous proteins from other methanogens

    • Assess if species-specific differences explain functional variations

What bioinformatic resources are most valuable for Mboo_0791 research?

Researchers should utilize:

  • Specialized archaeal databases:

    • UCSC Archaeal Genome Browser

    • ArchaeaDB

    • MeGAMerge (Methanogen Genome Analysis)

  • Protein family resources:

    • UPF0316 family entries in Pfam and InterPro

    • NCBI Protein Clusters for methanogen-specific protein families

    • Archaeal Clusters of Orthologous Genes (arCOGs)

  • Structural prediction tools:

    • AlphaFold2 for 3D structure prediction

    • SWISS-MODEL for homology modeling

    • PredictProtein for comprehensive protein feature prediction

  • Methanogen-specific resources:

    • MethanoCyc pathway database

    • Comparative genomic tools for methanogens

    • Methanogen transcriptome databases

  • Data integration platforms:

    • STRING for protein interaction networks

    • KEGG for pathway mapping

    • MetaboAnalyst for metabolic pathway analysis

Resource TypeSpecific ToolsPrimary Application
Structural AnalysisAlphaFold2, PyMOL, SWISS-MODEL3D structure prediction and visualization
Sequence AnalysisBLAST, MUSCLE, HMMERHomology detection and multiple sequence alignment
Functional PredictionInterProScan, eggNOG-mapperDomain and functional annotation
Archaeal DatabasesArchaeaDB, arCOGsMethanogen-specific comparative genomics
Expression AnalysisMetaTrans, DESeq2Transcriptomic data analysis for methanogens

How can Mboo_0791 research contribute to our understanding of methanogen biology?

Mboo_0791 research offers several promising avenues:

  • Methanogen-specific adaptations:

    • Investigate if Mboo_0791 represents a methanogen-specific innovation

    • Determine if it participates in unique methanogenic metabolic pathways

    • Explore potential roles in anaerobic adaptation mechanisms

  • Stress response networks:

    • Map Mboo_0791's place in oxidative stress response networks

    • Investigate connections to known methanogen stress regulators like MsvR

    • Determine if it functions in redox sensing similar to other methanogen proteins

  • Evolutionary insights:

    • Compare Mboo_0791 homologs across diverse methanogen lineages

    • Investigate if horizontal gene transfer played a role in its evolution

    • Examine if it represents an ancient protein family or a more recent adaptation

  • Ecological relevance:

    • Connect Mboo_0791 function to environmental adaptations

    • Investigate expression patterns in different environmental conditions

    • Determine if it contributes to methanogen survival in specific niches

  • Biotechnological applications:

    • Explore potential applications in anaerobic biotechnology

    • Investigate if understanding Mboo_0791 can improve methanogen-based bioreactors

    • Determine if it has properties useful for protein engineering applications

What emerging technologies might advance Mboo_0791 functional characterization?

Cutting-edge approaches include:

  • Cryo-electron microscopy:

    • Determine high-resolution structures without crystallization

    • Visualize different conformational states

    • Capture protein-protein complexes

  • Archaeal genetic systems:

    • Apply CRISPR-Cas9 systems adapted for methanogens

    • Develop regulatable expression systems for archaeal hosts

    • Create reporter systems for in vivo functional studies

  • Single-molecule techniques:

    • Apply FRET to study conformational dynamics

    • Use optical tweezers to investigate mechanical properties

    • Employ single-molecule tracking in living cells

  • Proteomics advances:

    • Apply thermal proteome profiling to identify binding partners

    • Use hydrogen-deuterium exchange mass spectrometry for conformational studies

    • Employ crosslinking mass spectrometry for interaction mapping

  • Computational approaches:

    • Apply molecular dynamics simulations at extended timescales

    • Use machine learning for function prediction from sequence

    • Employ systems biology approaches to place Mboo_0791 in metabolic networks

By integrating these emerging technologies with traditional approaches, researchers can develop a comprehensive understanding of Mboo_0791's role in methanogen biology and potentially discover novel functional mechanisms unique to these important archaeal organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.