Recombinant Methanosaeta thermophila Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant uppP is a 256-amino acid protein (UniProt ID: A0B9M2) expressed in Escherichia coli with an N-terminal His tag for purification . It catalyzes the hydrolysis of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP), a key step in regenerating the lipid carrier required for peptidoglycan and teichoic acid biosynthesis .

Biochemical Role

Undecaprenyl-diphosphatase is essential in bacterial cell wall biogenesis:

  • Substrate: Hydrolyzes UPP, a C55 isoprenoid diphosphate, to UP .

  • Function: Regenerates UP for iterative glycosyl transfer reactions in peptidoglycan assembly .

  • Biological Context: In methanogens like Methanosaeta thermophila, this enzyme supports structural integrity under extreme thermodynamic conditions .

Research Applications

Recombinant uppP is utilized in:

  1. Enzyme Kinetics: Studying inhibition mechanisms for antibiotic development .

  2. Structural Biology: Characterizing archaeal lipid metabolism and membrane biogenesis .

  3. Drug Discovery: High-throughput screening for UPPS/uppP inhibitors to combat methicillin-resistant Staphylococcus aureus (MRSA) and vancomycin-resistant Enterococci (VRE) .

Notable Findings

  • UPPS inhibitors (e.g., tetramic acids) show cross-reactivity with uppP, highlighting its potential as a drug target .

  • Methanosaeta thermophila homologs exhibit unique adaptations for survival in energy-limited environments, providing insights into archaeal resilience .

Expression and Purification

The recombinant protein is produced in E. coli with the following workflow:

  1. Gene Cloning: Full-length uppP (Mthe_1629 locus) inserted into an expression vector .

  2. Induction: IPTG-driven overexpression in bacterial cultures.

  3. Purification: Affinity chromatography via His tag, followed by buffer exchange .

Industrial and Medical Relevance

  • Antibiotic Adjuvants: Targeting uppP could restore sensitivity to β-lactams in resistant strains .

  • Biotechnological Tools: Used in enzymatic assays to quantify undecaprenyl phosphate pools in methanogens .

Challenges and Future Directions

  • Inhibitor Specificity: Differentiating UPPS (biosynthetic) and uppP (hydrolytic) activities remains critical for drug design .

  • Structural Insights: Cryo-EM studies of recombinant uppP could reveal mechanisms of lipid carrier regulation in archaea .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; Mthe_1629; Undecaprenyl-diphosphatase; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) (Methanosaeta thermophila)
Target Names
uppP
Target Protein Sequence
MDALQALVLGALQGITEWLPVSSEGQTMLAMISWLGMRPTDALSCSIFLHTGTMLAVLVR FRSRLLGMLNTESKLMRTVIVATLFTGITGVPLYMLFRDRFTGGEQATLLIGSLLIATGL MLRLRSSSTKDMEEISTKDMVLLGLAQGFSILPGVSRSGTTLTVLLMRGVKQDDALMVSF IISVPAVLGAIALDCLAGSPLSIRSLPGAVMLASSFITGYATMDVLMRFSRNVSFSWFCI TMGMITLALTALPEVQ
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP).
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanosaeta thermophila Undecaprenyl-diphosphatase (uppP)?

Undecaprenyl-diphosphatase (EC 3.6.1.27), encoded by the uppP gene (locus Mthe_1629) in Methanosaeta thermophila, is an enzyme involved in cell envelope biogenesis. The protein consists of 256 amino acids and functions as a phosphatase that hydrolyzes pyrophosphate bonds . This enzyme plays a critical role in the recycling of undecaprenyl pyrophosphate to undecaprenyl phosphate, an essential carrier lipid involved in cell wall biosynthesis pathways in this archaeal species.

How does Methanosaeta thermophila differ from other methanogenic archaea?

Methanosaeta thermophila is distinguished from other methanogens by several key characteristics:

  • It utilizes acetate as its sole substrate for methanogenesis, employing a specialized acetate activation pathway .

  • Unlike Methanosarcina species, M. thermophila lacks genes encoding the Rnf complex, suggesting it possesses an alternative electron transport pathway and energy conservation mechanism .

  • The organism possesses a unique cell wall sheath structure composed of functional amyloid proteins (primarily MspA) that provides structural integrity and selective permeability .

  • Its acetate activation pathway was initially thought to require two ATP molecules (compared to one in Methanosarcina), but research has shown it uses an AMP-forming acetyl-CoA synthetase .

These distinctive features enable M. thermophila to thrive at the thermodynamic limits that sustain life, making its enzymes potentially valuable for understanding energy-efficient biological processes .

What are the optimal expression systems for recombinant M. thermophila uppP?

When expressing recombinant M. thermophila uppP, researchers should consider several expression systems based on experimental goals:

  • E. coli-based expression systems: Using vectors like pASK-IBA3 or pASK-IBA5 with appropriate restriction sites (such as Eco31I or BveI) has been successful for other M. thermophila proteins . For membrane proteins like uppP, E. coli strains C41(DE3) or C43(DE3) are recommended due to their tolerance for toxic membrane proteins.

  • Thermophilic expression hosts: Since M. thermophila is thermophilic, expression in thermostable hosts like Thermus thermophilus or Sulfolobus species might yield better folding of the protein.

  • Cell-free systems: For challenging membrane proteins, cell-free expression systems supplemented with lipid environments can provide advantages for obtaining functional protein.

The choice depends on research objectives—structural studies might require higher purity achievable in specialized systems, while functional assays might work with simpler expression platforms.

What purification strategies yield highest activity for recombinant uppP?

Purification of recombinant M. thermophila uppP should be approached with careful consideration of its membrane-associated nature:

  • Solubilization optimization: Screen detergents including n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin at concentrations around their critical micelle concentration to identify optimal solubilization conditions.

  • Two-step chromatography approach:

    • Initial capture using immobilized metal affinity chromatography (IMAC) if a histidine tag is incorporated

    • Further purification using size exclusion chromatography to separate monomeric protein from aggregates

  • Storage considerations: The purified protein should be maintained in a buffer containing 50% glycerol and stored at -20°C or -80°C for extended storage, with working aliquots kept at 4°C for up to one week .

  • Activity preservation: Avoid repeated freeze-thaw cycles as these can significantly reduce enzymatic activity .

Successful purification can be validated through SDS-PAGE analysis, Western blotting, and enzymatic activity assays measuring phosphate release from undecaprenyl pyrophosphate substrates.

How can the enzymatic activity of recombinant uppP be measured?

Several complementary approaches can be employed to measure undecaprenyl-diphosphatase activity:

  • Phosphate release assay: This colorimetric method measures inorganic phosphate released from the dephosphorylation reaction using malachite green or other phosphate detection reagents.

  • Coupled enzyme assays: The pyrophosphate released can be measured by coupling to pyrophosphatase reactions followed by phosphate detection, similar to methods used for studying M. thermophila's soluble pyrophosphatase (KM = 0.27 ± 0.05 mM) .

  • Radiolabeled substrate approach: Using 32P-labeled undecaprenyl pyrophosphate allows for highly sensitive detection of enzymatic activity through scintillation counting.

  • HPLC-based assays: Separation and quantification of the substrate and product can be achieved through HPLC methods with appropriate detection.

Table 1: Comparison of Activity Assay Methods for Undecaprenyl-diphosphatase

MethodSensitivityEquipment RequirementsAdvantagesLimitations
Phosphate release (colorimetric)ModerateSpectrophotometerSimple, inexpensivePotential interference from phosphate contamination
Coupled enzymeHighSpectrophotometerReal-time monitoringRequires additional enzymes and optimization
Radiolabeled substrateVery highScintillation counterHighest sensitivityRequires radioisotope handling facilities
HPLC-basedHighHPLC systemDirect product quantificationRequires specialized equipment and method development

What are the optimal reaction conditions for M. thermophila uppP activity?

The optimal conditions for M. thermophila uppP activity should reflect its thermophilic nature and membrane-associated characteristics:

  • Temperature range: As a thermophilic enzyme, uppP likely exhibits optimal activity between 50-65°C, similar to other enzymes from M. thermophila.

  • pH optimum: Most archaeal phosphatases demonstrate maximal activity in the pH range of 7.0-8.5, with specific optimization required for uppP.

  • Buffer composition: Tris-based buffers supplemented with divalent cations (typically Mg2+ or Mn2+) are recommended as cofactors for phosphatase activity.

  • Detergent considerations: Maintaining a low concentration of non-ionic detergent (below CMC) in assay buffers helps stabilize the enzyme while preventing micelle formation that could interfere with substrate accessibility.

  • Substrate concentration range: Initial velocity studies should utilize undecaprenyl pyrophosphate concentrations spanning 0.1-10× the expected KM value to determine kinetic parameters.

Researchers should systematically vary these conditions to establish the optimal enzymatic activity profile specific to recombinant M. thermophila uppP.

What techniques are most effective for studying the membrane topology of M. thermophila uppP?

Understanding the membrane topology of uppP requires integrating computational predictions with experimental verification:

The integration of these approaches provides a comprehensive understanding of how uppP is positioned within the membrane and how this positioning relates to its catalytic function in undecaprenyl pyrophosphate processing.

How does the structure-function relationship in uppP compare to other phosphatases?

The structure-function relationship in M. thermophila uppP can be analyzed from several perspectives:

  • Comparative genomics: While uppP (Mthe_1629) has been identified in the M. thermophila genome, its sequence conservation pattern differs from phosphatases in bacteria, suggesting archaeal-specific adaptations in the catalytic mechanism.

  • Catalytic residues: Identification of conserved catalytic residues through multiple sequence alignment and site-directed mutagenesis studies reveals the essential amino acids for phosphate hydrolysis.

  • Substrate specificity determinants: The binding pocket for the undecaprenyl portion of the substrate may involve hydrophobic residues creating a suitable environment for the lipid substrate.

  • Thermal stability elements: As a thermophilic enzyme, uppP likely contains structural features contributing to thermal stability, such as increased salt bridges, hydrophobic interactions, and reduced flexible loops.

  • Membrane interaction domains: The transmembrane regions of uppP not only anchor the protein but likely position the catalytic site optimally relative to the membrane where its substrate is located.

Understanding these relationships provides insights into the evolutionary adaptations of this enzyme in archaeal cell wall biosynthesis pathways.

How does uppP function within the context of M. thermophila's unique cell wall structure?

M. thermophila possesses a distinctive cell wall featuring tubular sheaths composed of functional amyloid proteins, primarily MspA . The role of uppP within this unique cellular architecture involves:

  • Cell wall precursor recycling: UppP likely functions in recycling undecaprenyl pyrophosphate to undecaprenyl phosphate, which serves as a carrier lipid for cell wall building blocks.

  • Integration with amyloid-based architecture: The products of uppP activity may participate in the transport of precursors that ultimately contribute to the amyloid-based sheath structure, which provides M. thermophila with extraordinary resistance properties.

  • Coordination with cell division: The enzyme's activity may be spatiotemporally regulated to coordinate with cell division processes, ensuring proper distribution of cell wall materials.

  • Adaptation to extreme conditions: As M. thermophila thrives at thermodynamic limits, uppP likely operates with high efficiency despite energetic constraints, representing an adaptation to the organism's ecological niche.

Understanding uppP's role provides insights into the unique adaptations of archaeal cell envelope biogenesis under energy-limited conditions.

What is known about the regulation of uppP expression in response to environmental factors?

The regulation of uppP expression in M. thermophila likely responds to several environmental cues:

  • Temperature-dependent regulation: As a thermophilic organism, M. thermophila may modulate uppP expression in response to temperature fluctuations, potentially through thermosensitive transcriptional regulators.

  • Growth phase-dependent expression: Similar to other M. thermophila genes, uppP expression might vary between exponential and stationary growth phases, with potential upregulation during active cell wall synthesis.

  • Substrate availability effects: In acetate-dependent growth conditions, the expression of cell envelope components including uppP may be coordinated with central metabolic pathways.

  • Stress response mechanisms: Cell wall integrity pathways might influence uppP expression during osmotic or other environmental stresses that affect cell envelope stability.

  • Transcriptional coordination: RNA analysis techniques similar to those used for other M. thermophila genes (using appropriate reference genes for ΔtC calculations) would be appropriate for studying uppP transcriptional regulation .

Research into these regulatory mechanisms would benefit from qRT-PCR approaches and promoter analysis to identify specific transcriptional control elements.

How does M. thermophila uppP differ from bacterial undecaprenyl pyrophosphatases?

M. thermophila uppP exhibits several distinctive features compared to its bacterial counterparts:

This comparative perspective provides insights into domain-specific adaptations in phosphatase enzymes central to cell envelope biogenesis.

What evolutionary insights can be gained from studying archaeal phosphatases like uppP?

Studying M. thermophila uppP provides valuable evolutionary insights:

  • Deep evolutionary relationships: Analysis of archaeal phosphatases like uppP can illuminate the evolutionary history of phosphate metabolism across the three domains of life, potentially revealing ancient conserved mechanisms.

  • Adaptation to extreme environments: As M. thermophila thrives in thermophilic conditions with severe energy limitations , its enzymes (including uppP) represent adaptations to life at thermodynamic extremes.

  • Functional convergence: Despite sequence divergence, functional similarities between archaeal and bacterial phosphatases may represent cases of convergent evolution or conservation of critical catalytic strategies.

  • Horizontal gene transfer assessment: Comparative genomics approaches can reveal potential horizontal gene transfer events that may have shaped the evolution of cell wall biosynthesis pathways.

  • Ancestral reconstruction: The study of archaeal phosphatases contributes to understanding the characteristics of the last universal common ancestor (LUCA) and the early diversification of cellular life.

These evolutionary perspectives enhance our understanding of both archaeal biology and the broader evolution of essential cellular processes.

How can recombinant M. thermophila uppP be utilized in inhibitor development studies?

Recombinant M. thermophila uppP offers several applications for inhibitor development studies:

  • High-throughput screening platforms: The purified enzyme can be incorporated into fluorescence-based or colorimetric assays suitable for screening chemical libraries for novel inhibitors.

  • Structure-based drug design: If structural data becomes available, computational approaches can design targeted inhibitors against the archaeal enzyme's active site.

  • Comparative inhibition studies: Testing known bacterial undecaprenyl pyrophosphatase inhibitors against the archaeal enzyme can reveal domain-specific differences in inhibitor sensitivity.

  • Mechanism-based inhibitor development: Understanding the catalytic mechanism allows for designing transition-state analogs or mechanism-based inhibitors.

  • Thermal stability advantages: The thermostable nature of this enzyme permits inhibitor screening at elevated temperatures, potentially identifying compounds with improved pharmacological properties.

While archaeal enzymes themselves may not be direct therapeutic targets, insights gained from such studies contribute to broader antimicrobial development strategies.

What potential biotechnological applications exist for thermostable phosphatases like M. thermophila uppP?

The thermostable nature of M. thermophila uppP presents several biotechnological opportunities:

  • Biocatalysis applications: The enzyme could potentially be engineered for industrial dephosphorylation reactions requiring elevated temperatures, providing advantages in terms of reaction rates and reduced contamination risk.

  • Biosensor development: Thermostable phosphatases can be incorporated into robust biosensors for detecting phosphorylated compounds in various applications, from environmental monitoring to bioprocess control.

  • Structural biology research tools: As a model thermostable membrane enzyme, uppP can serve as a platform for developing improved methods for membrane protein expression, purification, and crystallization.

  • Directed evolution templates: The inherent stability of thermophilic enzymes like uppP provides an excellent starting point for directed evolution experiments aimed at generating phosphatases with novel specificities or improved catalytic properties.

  • Educational and research reagents: Purified thermostable enzymes are valuable teaching and research tools due to their resistance to denaturation during handling and storage.

These applications leverage the unique properties of archaeal thermostable enzymes for both research and potential commercial applications.

What are common pitfalls in working with recombinant M. thermophila uppP and how can they be addressed?

Researchers working with recombinant M. thermophila uppP may encounter several challenges:

  • Low expression yields:

    • Problem: Membrane proteins often express poorly in heterologous systems.

    • Solution: Optimize codon usage, try fusion tags (such as MBP), lower induction temperature, or use specialized expression strains like C41(DE3).

  • Protein aggregation:

    • Problem: Improper folding leading to inclusion bodies or aggregation.

    • Solution: Express at lower temperatures (16-20°C), optimize induction conditions, or consider refolding protocols from inclusion bodies.

  • Loss of activity during purification:

    • Problem: Detergent solubilization can disrupt enzyme function.

    • Solution: Screen multiple detergents at minimal effective concentrations; consider nanodisc or liposome reconstitution for activity measurements.

  • Substrate solubility issues:

    • Problem: Undecaprenyl pyrophosphate has limited solubility in aqueous buffers.

    • Solution: Prepare substrate in appropriate detergent micelles or liposomes; consider developing modified substrates with improved solubility.

  • Temperature-dependent assay complications:

    • Problem: Conducting assays at elevated temperatures can introduce artifacts.

    • Solution: Include appropriate controls for non-enzymatic hydrolysis; consider thermostable coupling enzymes for continuous assays.

Systematic troubleshooting and method optimization are essential for successful characterization of this challenging enzyme.

How can researchers validate the authenticity and activity of recombinant M. thermophila uppP?

Multiple complementary approaches should be employed to validate recombinant M. thermophila uppP:

  • Molecular authentication:

    • Mass spectrometry confirmation of protein identity

    • N-terminal sequencing to verify the correct start point

    • Peptide mapping against the expected sequence

  • Structural integrity verification:

    • Circular dichroism spectroscopy to assess secondary structure

    • Size-exclusion chromatography to confirm monomeric state

    • Thermal shift assays to verify expected thermostability profile

  • Functional validation:

    • Compare specific activity against published values for related phosphatases

    • Verify expected substrate specificity and kinetic parameters

    • Confirm appropriate response to known phosphatase inhibitors

  • Thermostability confirmation:

    • Activity retention after heat treatment (e.g., 60-70°C)

    • Long-term stability at elevated temperatures

    • Comparison to mesophilic phosphatases as controls

  • Response to physiological regulators:

    • Validation of expected cofactor requirements

    • Verification of pH optimum consistent with archaeal enzymes

This multi-faceted validation approach ensures reliable experimental outcomes when working with this specialized enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.