Recombinant Methanosaeta thermophila UPF0290 protein Mthe_1386 (Mthe_1386)

What is the structural characterization of Methanosaeta thermophila UPF0290 protein Mthe_1386?

Methanosaeta thermophila UPF0290 protein Mthe_1386 is a 178-amino acid protein found in the archaeal organism Methanosaeta thermophila (strain DSM 6194/PT), also known as Methanothrix thermophila. The protein has a molecular structure characterized by multiple transmembrane regions with a predominant hydrophobic amino acid composition. Its amino acid sequence (MNIIVHSIWLMLPAYVPNNFAALFGGGTPLDMGMSLPDGHRVFGNGKTIRGTIAGGIAGGIIIVGLLQNSIAGVFGLPSFGDGMELFLVLFGLSAGSMLGDLTASFIKRRLGMKRGASFFLVDQLDFVMGAWALTFLLAPEWFNAQFTSPVIILVLLITPVLHRFANVIGYMIGAKKEPW) suggests it contains multiple membrane-spanning domains, which is consistent with its putative role in cellular membrane processes .

How does Methanosaeta thermophila UPF0290 protein Mthe_1386 compare to homologous proteins in other methanogenic archaea?

When comparing Mthe_1386 to homologous proteins such as Mhun_1107 from Methanospirillum hungatei, several structural and functional similarities can be observed. Both proteins belong to the UPF0290 family and exhibit similar hydrophobic profiles with multiple predicted transmembrane domains. The Mhun_1107 protein (166 amino acids) shares approximately 58% sequence identity with Mthe_1386 (178 amino acids), with conserved regions primarily in the membrane-spanning segments. Key differences include:

These differences likely reflect adaptations to the specific membrane environments and metabolic requirements of their respective archaeal hosts .

What expression systems are commonly used for producing recombinant Mthe_1386?

For the recombinant production of Mthe_1386, E. coli-based expression systems are most commonly employed. Similar archaeal membrane proteins like Mhun_1107 are successfully expressed in E. coli with N-terminal His-tags for purification purposes. For Mthe_1386, the optimal expression conditions typically include:

• Use of BL21(DE3) or Rosetta 2(DE3) E. coli strains to accommodate potential rare codon usage

• Expression vectors with T7 promoters (pET series) for controlled induction

• Reduced growth temperature (16-20°C) during induction to facilitate proper protein folding

• Addition of membrane-stabilizing components in the culture medium

The protein can be extracted using detergent solubilization methods followed by immobilized metal affinity chromatography (IMAC) for purification of the tagged recombinant protein .

How does the structural integrity of Mthe_1386 respond to high hydrostatic pressure conditions typical of deep anaerobic environments?

Given that Methanosaeta species are found in various anaerobic environments including deep sediments, understanding the structural response of Mthe_1386 to high hydrostatic pressure (HHP) is relevant. Research on protein structures under HHP indicates that membrane proteins often undergo significant conformational changes under pressure:

• At moderate pressures (200-300 MPa), Mthe_1386 would likely experience disruption of intermolecular β-sheet structures compensated by the formation of intramolecular β-sheets, similar to observations in other membrane proteins.

• At higher pressures (400-500 MPa), significant refolding can occur with β-turn formation becoming predominant, potentially altering protein functionality.

• The hydrophobic transmembrane domains of Mthe_1386 would be particularly susceptible to pressure-induced changes due to volume changes associated with water penetration into protein cavities.

These structural modifications under HHP conditions may explain adaptations of Methanosaeta to various environmental niches including deeper sediment layers where hydrostatic pressure increases .

What role might Mthe_1386 play in direct interspecies electron transfer (DIET) between Methanothrix thermoacetophila and exoelectrogenic bacteria?

Recent research has revealed that Methanothrix (formerly Methanosaeta) species can participate in direct interspecies electron transfer (DIET) with exoelectrogenic bacteria such as Geobacter metallireducens. Although the specific role of Mthe_1386 in this process has not been directly established, its membrane localization and structural features suggest potential involvement in electron transfer mechanisms:

• The multiple transmembrane domains of Mthe_1386 could potentially form channels or interact with other membrane components involved in electron transport.

• Transcriptomic studies of Methanothrix growing via DIET show upregulation of membrane proteins, potentially including UPF0290 family members, during co-culture with Geobacter.

• The addition of conductive materials like magnetite nanoparticles enhances growth of Methanothrix in co-cultures, suggesting that membrane proteins may interact with these conductive surfaces to facilitate electron transfer.

This hypothesis warrants investigation through targeted gene knockout studies and protein-protein interaction analyses to determine if Mthe_1386 contributes to the remarkable capability of Methanothrix to accept electrons directly from exoelectrogenic partners .

How does post-translational modification affect the function and stability of Mthe_1386 in different methanogenic pathways?

Post-translational modifications (PTMs) of archaeal membrane proteins significantly influence their function and stability. For Mthe_1386, several potential PTMs could affect its role in methanogenic pathways:

• Phosphorylation: Bioinformatic analysis predicts 3-5 potential phosphorylation sites in Mthe_1386, primarily on serine and threonine residues. These modifications could regulate protein-protein interactions within membrane complexes.

• Methylation: Archaeal proteins often undergo methylation, particularly at lysine residues. Mthe_1386 contains several lysine residues that could be targets for methylation, potentially affecting protein stability.

• Archaeal-specific lipid modifications: As a membrane protein, Mthe_1386 may undergo archaeol or caldarchaeol lipid attachment, which would anchor it more firmly in the unique archaeal membrane.

These modifications may vary depending on whether Methanothrix is growing via acetoclastic methanogenesis or through DIET. Methodologically, identifying these PTMs requires specialized mass spectrometry approaches, including enrichment techniques specific to each modification type and fragmentation methods that preserve labile PTMs .

What are the optimal conditions for solubilizing and purifying recombinant Mthe_1386 while maintaining native conformation?

Membrane proteins like Mthe_1386 present significant challenges for solubilization and purification while preserving native structure. The optimal protocol involves:

• Cell lysis: Gentle disruption using enzymatic methods (lysozyme treatment) combined with mild physical disruption (French press at 10,000 psi) in buffer containing protease inhibitors.

• Membrane extraction: Ultracentrifugation (100,000 × g for 1 hour) to isolate membrane fractions.

• Solubilization: Testing different detergents is critical:

  • Primary options: n-Dodecyl β-D-maltoside (DDM, 1-2%) or digitonin (1%)

  • Alternative options: CHAPS (1%) or Triton X-100 (0.5%)

  • Incubation: 4°C for 2-4 hours with gentle rotation

• Purification strategy:

  • IMAC using Ni-NTA resin for His-tagged protein

  • Gradual detergent reduction during washing steps

  • Elution with imidazole gradient (50-300 mM)

  • Size exclusion chromatography for final polishing

• Stability assessment: Circular dichroism spectroscopy to verify secondary structure integrity compared to predicted models .

What techniques are most effective for analyzing the interaction between Mthe_1386 and other membrane components in Methanothrix?

Analyzing membrane protein interactions requires specialized approaches tailored to hydrophobic environments. For Mthe_1386, the following techniques yield the most reliable results:

• Crosslinking mass spectrometry (XL-MS):

  • Use of membrane-permeable crosslinkers (DSS, BS3)

  • Mild UV-inducible crosslinkers for zero-length interactions

  • Analysis by nano-LC-MS/MS with specialized search algorithms for crosslinked peptides

• Microscale thermophoresis (MST):

  • Label-free detection of interactions in detergent micelles

  • Ability to determine binding affinities in near-native conditions

  • Requires minimal protein amounts (500 ng - 1 μg)

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Maps protein interaction interfaces through differential deuterium uptake

  • Provides dynamic information on conformational changes upon binding

  • Compatible with detergent-solubilized membrane proteins

• Co-immunoprecipitation with specific antibodies against Mthe_1386:

  • Gentle solubilization in digitonin (1%)

  • Analysis of co-precipitated proteins by mass spectrometry

  • Validation with reciprocal pulldowns

These methods can reveal Mthe_1386's interaction partners within electron transport complexes or other membrane protein assemblies .

How can transcriptomic data be optimally integrated with protein function analysis to understand Mthe_1386's role in different methanogenic conditions?

Integrating transcriptomic data with protein function analysis requires a systematic approach:

• Experimental design for transcriptomics:

  • Compare Methanothrix growing via acetoclastic methanogenesis versus DIET

  • Include conditions with conductive materials (magnetite, GAC)

  • Collect samples at multiple time points to capture temporal expression patterns

• Data processing pipeline:

  • RNA extraction using modified TRIzol protocol optimized for archaeal cells

  • Strand-specific library preparation to capture antisense transcription

  • Deep sequencing (>30M reads) with paired-end strategy

  • Custom bioinformatic pipeline accounting for archaeal features

• Integration with protein analysis:

  • Targeted proteomics (SRM/MRM) to quantify Mthe_1386 levels

  • Correlation of transcript and protein abundance

  • In vitro reconstitution experiments guided by co-expression patterns

• Functional validation:

  • Site-directed mutagenesis of key residues identified through conservation analysis

  • Heterologous expression in model archaeal hosts

  • Activity assays under different electron donor/acceptor conditions

This integrated approach can reveal whether Mthe_1386 expression changes during different growth conditions and correlate these changes with specific functional roles in electron transfer or membrane integrity .

How can structural knowledge of Mthe_1386 contribute to understanding methane production in natural and engineered environments?

Understanding the structure and function of Mthe_1386 has significant implications for methane production research:

• Biogas production optimization:

  • Identifying rate-limiting steps in electron transfer processes

  • Engineering more efficient anaerobic digesters through targeted interventions

  • Developing biosensors based on Mthe_1386 and related proteins to monitor methanogenic activity

• Climate change research:

  • Predicting methane emission rates from natural environments

  • Understanding methanogen adaptation to changing environmental conditions

  • Developing mitigation strategies for high-methane producing environments

• Structural models:

  • The transmembrane topology of Mthe_1386 can inform broader understanding of archaeal membrane proteins

  • Comparative analysis with bacterial homologs provides evolutionary insights

  • Structure prediction using AlphaFold or RoseTTAFold can guide functional hypotheses

By characterizing proteins like Mthe_1386, researchers can better understand the molecular mechanisms underlying methanogenesis in diverse environments ranging from polar sediments to anaerobic digesters .

What are the methodological challenges in using recombinant Mthe_1386 for antibody production and immunolocalization studies?

Developing antibodies against archaeal membrane proteins presents several challenges:

• Antigen preparation challenges:

  • Full-length Mthe_1386 may not maintain native conformation during purification

  • Synthetic peptides corresponding to hydrophilic loops offer alternative approach

  • Multiple peptide antigens may be needed to ensure sufficient specificity

• Host selection considerations:

  • Rabbits typically produce higher-affinity antibodies for archaeal proteins

  • Consider using chickens (IgY) for highly conserved archaeal proteins

  • Mouse monoclonal antibodies may require multiple immunization strategies

• Validation protocol:

  • Western blotting against both recombinant protein and native cell extracts

  • Peptide competition assays to confirm specificity

  • Testing against knockout strains (if available) or heterologous expression systems

• Immunolocalization optimization:

  • Modified fixation protocols for archaeal cells (2% paraformaldehyde with 0.1% glutaraldehyde)

  • Detergent permeabilization conditions (0.1% Triton X-100, 5-10 minutes)

  • Super-resolution microscopy techniques for precise membrane localization

These antibodies, once developed and validated, would enable precise localization of Mthe_1386 within the cell membrane and potentially identify clustering with other proteins involved in electron transfer or membrane organization .

How might genetic manipulation of Mthe_1386 affect the efficiency of direct interspecies electron transfer in methanogenic communities?

Genetic manipulation of Mthe_1386 could significantly impact DIET efficiency:

• Potential approaches:

  • CRISPR-Cas9 mediated knockout or knockdown

  • Site-directed mutagenesis of key residues

  • Controlled overexpression using inducible promoters

• Expected outcomes:

  • If Mthe_1386 is involved in electron transfer, modified strains would show altered DIET capabilities

  • Changes in aggregate formation with exoelectrogenic partners

  • Modified response to conductive materials like magnetite

• Experimental design:

  • Co-culture experiments with Geobacter metallireducens

  • Measurement of methane production rates

  • Microscopic analysis of cell-cell interactions

  • Electrochemical characterization of electron transfer kinetics

• Broader implications:

  • Potential for engineering more efficient methanogenic consortia

  • Development of bioelectrochemical systems with enhanced performance

  • Understanding of fundamental mechanisms in interspecies communication

These genetic approaches would provide definitive evidence regarding Mthe_1386's role in DIET and potentially enable engineering of enhanced methanogenic partnerships .

What computational approaches can best predict the interaction of Mthe_1386 with conductive materials like magnetite in enhanced methanogenesis systems?

Computational modeling of protein-mineral interactions provides valuable insights:

• Molecular dynamics simulations:

  • All-atom simulations of Mthe_1386 in membrane environment

  • Integration of magnetite surface models with explicit water

  • Analysis of binding energies and conformational changes

  • Recommended software: GROMACS or NAMD with specialized force fields for mineral surfaces

• Quantum mechanical approaches:

  • Density functional theory calculations for electron transfer energetics

  • Hybrid QM/MM methods for active site interactions

  • Marcus theory parameters for electron transfer rates

• Machine learning integration:

  • Feature extraction from protein sequences across methanogenic archaea

  • Correlation with experimental electron transfer rates

  • Prediction of optimal protein-mineral interfaces

• Model validation approach:

  • Site-directed mutagenesis of predicted interaction residues

  • Surface plasmon resonance measurements of binding kinetics

  • Electrochemical impedance spectroscopy for electron transfer rates

These computational approaches can guide experimental design and provide mechanistic understanding of how proteins like Mthe_1386 might interact with conductive surfaces to enhance electron transfer rates .