Recombinant Methanosarcina acetivorans CoB--CoM heterodisulfide reductase 2 subunit E (hdrE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on multiple factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
hdrE; MA_0687; Dihydromethanophenazine:CoB--CoM heterodisulfide reductase subunit E; CoB--CoM heterodisulfide reductase subunit E; Coenzyme B:coenzyme M:methanophenazine oxidoreductase subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Target Names
hdrE
Target Protein Sequence
MSSEMAYFSGLTDALRLTFVQIMILSTIAIVVFLYGMILNFQKWGAGVTGYALEPQAGSK GSAIRFLKTWWGQVVEESHHGHGKPILEVLILDILFQRRILKRSPLRWFMHFTIFAGWMT LFALSGLMFAVEMTEKFGIELPFTPAEFREFLSIPNYIFGYILLIGVLIALVRRIVVSDV REASIMYDWILIGGVFLVTISGFVADGIRTGIIWGFGLDPTTAPPAALFHSVISLFFCIA YIPYSKYIHVIATPLAILANKGGE
Uniprot No.

Target Background

Function
This protein is part of a complex responsible for catalyzing the reversible reduction of CoM-S-S-CoB to the thiol-coenzymes H-S-CoM (coenzyme M) and H-S-CoB (coenzyme B). HdrE may play a role in anchoring the complex to the membrane.
Database Links

KEGG: mac:MA_0687

STRING: 188937.MA0687

Protein Families
HdrE family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of HdrED in methanogenic archaea?

HdrED functions as a terminal electron acceptor enzyme in methane-producing archaea (methanogens). These organisms grow by converting substrates to methane gas in a process called methanogenesis. Research has demonstrated that the reduction of the terminal electron acceptor is the rate-limiting step in methanogenesis by Methanosarcina acetivorans. The HdrED enzyme specifically catalyzes the reduction of the CoM-S-S-CoB heterodisulfide to the corresponding thiols (CoM-SH and CoB-SH), which is essential for completing the methanogenic pathway .

How does HdrED depletion affect cellular metabolism?

When HdrED is depleted in vivo, several significant metabolic changes occur. The depletion results in a higher abundance of transcripts for methyltransferases (including mtaC2, mtaB3, mtaC3) and creates an immediate imbalance in CoM-S-S-CoB/CoM-SH + CoB-SH metabolite pools. Additionally, this depletion leads to a collapse of the transmembrane proton gradient. These effects highlight the complex interplay between CoM-S-S-CoB and ATP concentrations in the cell . The table below summarizes these metabolic effects:

Effect of HdrED DepletionMetabolic Consequence
Increased methyltransferase transcriptsAltered methylotrophic metabolism
Imbalanced CoM-S-S-CoB/CoM-SH + CoB-SH poolsDisrupted redox balance
Collapsed transmembrane proton gradientCompromised energy conservation
Changes in gene expressionComplex regulatory responses

How should experiments be designed to study HdrED function?

When designing experiments to study HdrED function, researchers should follow systematic experimental design principles. The process begins with clearly defining research questions and formulating testable hypotheses. For HdrED research, this requires identifying relevant independent variables (such as HdrED expression levels, substrate concentrations, or environmental conditions) and dependent variables (such as methanogenesis rates, metabolite concentrations, or gene expression levels) .

A well-designed HdrED experiment should:

  • Clearly identify independent and dependent variables

  • Control extraneous variables systematically

  • Include appropriate controls (positive, negative, and experimental)

  • Employ randomization techniques when applicable

  • Determine appropriate sample sizes based on power analysis

  • Establish reliable measurement techniques for all variables

What controls are necessary when studying HdrED depletion?

When studying HdrED depletion effects, implementing proper controls is crucial for valid interpretation of results. The following control strategies should be considered:

Control TypeImplementation StrategyPurpose
Positive ControlWild-type cells with normal HdrED expressionEstablish baseline cellular function
Negative ControlCells with depleted HdrED under non-inducing conditionsAccount for non-specific effects
Time-course ControlsSampling at multiple time points during depletionTrack progressive effects of depletion
Complementation ControlHdrED-depleted cells with restored HdrED expressionVerify phenotype reversibility
External Variable ControlsStandardized growth conditions, media compositionMinimize confounding factors

Proper implementation of these controls helps distinguish between direct effects of HdrED depletion and secondary metabolic responses, allowing for more accurate interpretation of experimental results .

How can I address unexpected results in HdrED research?

When experimental data contradicts your hypothesis about HdrED function, a systematic approach is necessary. Begin by thoroughly examining the data to identify discrepancies between expected and observed results. This involves analyzing outliers, verifying data quality, and comparing findings with existing literature .

The recommended steps for addressing contradictory results include:

  • Re-examine experimental procedures for methodological errors

  • Verify reagent quality and experimental conditions

  • Evaluate initial assumptions about HdrED function

  • Consider alternative explanations for the observed phenomena

  • Design follow-up experiments to test new hypotheses

  • Refine variables and implement additional controls

  • Consult with colleagues for fresh perspectives on the data

Unexpected results often lead to new discoveries about enzyme function. For example, contradictory findings regarding HdrED activity might reveal previously unknown regulatory mechanisms or interactions with other cellular components .

What are effective approaches for studying HdrED regulation in gene expression networks?

Studying HdrED regulation requires sophisticated methodologies that can capture the complex interplay between metabolic flux and gene expression. Research has shown that M. acetivorans lacks bacterial-like stringent response mechanisms, making the study of metabolic regulation particularly challenging and potentially fruitful for novel discoveries .

The following approaches have proven effective:

  • Transcriptomic Analysis: RNA-seq to identify changes in gene expression patterns following HdrED depletion, focusing on methyltransferases and related genes.

  • Metabolomic Profiling: Quantification of CoM-S-S-CoB/CoM-SH + CoB-SH metabolite pools to understand the metabolic consequences of HdrED depletion.

  • Chromatin Immunoprecipitation (ChIP-seq): Identification of potential regulatory proteins that may interact with the hdrED promoter region.

  • Reporter Gene Assays: Construction of reporter gene fusions to monitor hdrED expression under various conditions.

  • Protein-Protein Interaction Studies: Identification of protein partners that may regulate HdrED activity post-translationally .

How can computational modeling enhance our understanding of HdrED function?

Computational modeling offers powerful tools for integrating diverse experimental data on HdrED function. Models can simulate the effects of HdrED depletion on metabolic flux, predict regulatory interactions, and generate testable hypotheses for experimental validation.

A comprehensive computational approach to HdrED research might include:

  • Metabolic Flux Analysis (MFA): Mathematical modeling of carbon and electron flow through methanogenic pathways, with focus on the rate-limiting step catalyzed by HdrED.

  • Protein Structure Prediction: In silico modeling of HdrED structure to identify catalytic residues and potential regulatory sites.

  • Systems Biology Approaches: Integration of transcriptomic, proteomic, and metabolomic data to create holistic models of HdrED function within cellular networks.

  • Machine Learning Applications: Pattern recognition algorithms to identify subtle regulatory relationships in large datasets generated from HdrED studies.

These computational approaches, when combined with rigorous experimental validation, can significantly accelerate our understanding of HdrED's role in methanogenesis .

What are common pitfalls in HdrED expression systems and how can they be addressed?

Recombinant expression of HdrED presents several challenges due to the enzyme's archaeal origin and complex structure. Common pitfalls and their solutions include:

ChallengeSolution Strategy
Low expression yieldsOptimize codon usage for expression host; use archaeal-specific expression systems
Protein misfoldingExpress at lower temperatures; include archaeal chaperones in expression system
Loss of activityInclude appropriate cofactors in purification buffers; maintain anaerobic conditions
Subunit dissociationUse co-expression strategies for HdrE and HdrD subunits; optimize purification protocols
Contaminating activitiesImplement multiple purification steps; validate enzyme purity by mass spectrometry

Successfully addressing these challenges requires careful optimization of expression conditions, purification protocols, and activity assays specific to HdrED .

How can I formulate rigorous research questions for HdrED studies?

Formulating rigorous research questions is the foundation of successful HdrED research. The PICO framework (Patient/population; Intervention; Comparison; Outcome) can be adapted for HdrED studies as follows:

  • Population: The specific strain of M. acetivorans or expression system being studied

  • Intervention: Manipulation of HdrED (e.g., depletion, mutation, overexpression)

  • Comparison: Control conditions or alternative manipulations

  • Outcome: Measured effects (e.g., metabolite levels, gene expression, growth rates)

Additionally, the FINER criteria (Feasible; Interesting; Novel; Ethical; and Relevant) help evaluate research questions for practical considerations .

For example, a well-formulated research question might be: "How does controlled depletion of HdrED in M. acetivorans grown on methanol affect the transcription of methyltransferase genes compared to wild-type cells, as measured by RNA-seq analysis?"

What statistical approaches are most appropriate for analyzing HdrED functional studies?

The analysis of data from HdrED functional studies requires robust statistical methods to account for biological variability and experimental noise. Appropriate statistical approaches include:

  • Descriptive Statistics: Calculation of means, medians, standard deviations, and confidence intervals for enzyme activity measurements.

  • Inferential Statistics: Application of t-tests, ANOVA, or non-parametric alternatives to compare experimental groups.

  • Regression Analysis: Examination of relationships between HdrED activity and various experimental parameters.

  • Multivariate Analysis: Principal component analysis (PCA) or cluster analysis for complex datasets integrating multiple variables.

  • Time-Series Analysis: Statistical methods for analyzing temporal changes in metabolite concentrations or gene expression following HdrED depletion .

The choice of statistical method should be guided by the experimental design, data structure, and specific research questions being addressed.

How should conflicting data about HdrED function be evaluated and reconciled?

When faced with conflicting data about HdrED function, researchers should implement a systematic evaluation process:

  • Assess Methodology: Compare experimental protocols, controls, and analytical methods used in conflicting studies.

  • Consider Biological Context: Evaluate differences in strains, growth conditions, or physiological states that might explain discrepancies.

  • Examine Assumptions: Identify unstated assumptions that might differ between studies.

  • Perform Meta-Analysis: When sufficient data exists, conduct formal meta-analysis to integrate findings across studies.

  • Design Reconciliation Experiments: Develop experiments specifically designed to address and resolve contradictions .

This process should be approached with scientific rigor and openness to alternative interpretations, recognizing that seemingly contradictory results often reflect different aspects of complex biological systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.