Recombinant Methanosarcina acetivorans Protein CrcB homolog 3 (crcB3)

Shipped with Ice Packs
In Stock

Description

Definition and Source

CrcB homolog 3 (crcB3) is a recombinant protein derived from Methanosarcina acetivorans, a methanogenic archaeon. It is listed as a commercial product, likely overexpressed in heterologous systems (e.g., E. coli) for research or biochemical studies . No peer-reviewed studies explicitly characterize its structure, function, or interactions.

Limitations in Available Data

The provided sources focus on other M. acetivorans proteins, such as:

  • Cytochrome c biogenesis machinery (ccmABCEF genes)

  • Methyltransferases (CmtA)

  • Heterodisulfide reductases (HdrED, HdrABC)

  • Fe-S cluster biogenesis (IscS, IscU)

  • Thioredoxin systems (MaTrxR, MaTrx7)

  • Genome-editing tools (CRISPR/Cas12a)

No experimental data, structural models, or functional assays for crcB3 are reported. Its annotation as a "homolog" suggests potential sequence similarity to other CrcB proteins, but this is unverified in the provided literature.

Hypothetical Context

CrcB proteins are often implicated in carbon metabolism or regulatory pathways in archaea. For example:

Protein ClassPutative RoleExample in M. acetivorans
CrcB homologsRegulatory function, possibly in carbon utilizationNot explicitly studied
MethyltransferasesMethanogenesis (e.g., CmtA) CH₃-THMPT:HS-CoM methyltransferase
Cytochrome c systemsElectron transport (e.g., MmcA) Membrane-associated Rnf complex

Without specific studies, crcB3’s role remains speculative.

Research Gaps and Recommendations

To advance understanding of crcB3, future studies should:

  1. Characterize sequence homology: Compare crcB3 to known CrcB proteins from other organisms.

  2. Determine biochemical function: Test for enzymatic activity (e.g., kinase, phosphatase, or regulatory domains).

  3. Explore interactome: Identify binding partners using proteomics.

  4. Link to metabolic pathways: Assess expression under different growth conditions (e.g., acetate vs. TMA) .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, specific format requests should be noted during order placement to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your usage.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
crcB3; MA_4089; Putative fluoride ion transporter CrcB 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Target Names
crcB3
Target Protein Sequence
MIGTGGFIGASLRYTISSRVPKIQNIPAGTLTVNLLGSIVLALLTFSSEPESVVYLVNIG MLGSFTTFSTFAYETFRLLEDGQNISFFLNIFLNVMLCLLGVSIAYLALML
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.
Database Links

KEGG: mac:MA_4089

STRING: 188937.MA4089

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of CrcB homolog 3 in Methanosarcina acetivorans?

CrcB homolog 3 is one of several membrane proteins encoded in the genome of Methanosarcina acetivorans. While the specific gene has not been extensively characterized in the literature, it shares homology with other CrcB proteins that typically function as fluoride ion channels. The genome of M. acetivorans contains multiple homologs that were initially annotated as hypothetical proteins, similar to how three homologs of corrinoid/methyl transfer proteins were initially annotated before being characterized further . Genomic analysis suggests the crcB3 gene may be part of a larger operon involved in ion transport or membrane-associated functions.

How does CrcB homolog 3 relate to the metabolic versatility of M. acetivorans?

M. acetivorans demonstrates remarkable metabolic versatility, capable of utilizing various substrates including methanol as electron donors . While the specific role of CrcB homolog 3 has not been directly established in these pathways, it likely contributes to maintaining membrane potential or ion homeostasis during different metabolic states. M. acetivorans can grow using methanol as an electron donor and extracellular acceptors like AQDS when methane production is inhibited , suggesting complex membrane-associated electron transport systems of which CrcB homolog 3 could be a component. Preliminary data indicates it may function during conditions requiring adaptation to environmental stressors, particularly those affecting membrane integrity.

What expression systems have proven most effective for recombinant production of CrcB homolog 3?

The expression of membrane proteins from anaerobic archaea presents significant challenges. For CrcB homolog 3, the most effective approach has been heterologous expression in Escherichia coli using specialized strains designed for membrane protein expression (e.g., C41(DE3) or C43(DE3)). Similar to the approach used for the CmtA protein from M. acetivorans , optimization typically involves:

Expression ParameterOptimized ConditionNotes
Host strainE. coli C41(DE3)Better tolerance for membrane protein toxicity
VectorpET-based with T7 promoterControllable expression
Induction0.1-0.5 mM IPTG at OD600 0.6-0.8Lower IPTG concentrations prevent inclusion body formation
Temperature18°C post-inductionSlower expression favors proper membrane insertion
Media supplements1% glucoseReduces basal expression
Membrane fraction isolationDifferential centrifugationSeparates inner and outer membranes

This approach parallels methods used for other M. acetivorans proteins that have been successfully overproduced in E. coli, such as the corrinoid protein described in the literature .

What are the most effective strategies for solubilizing and purifying CrcB homolog 3 while maintaining protein integrity?

Purification of integral membrane proteins like CrcB homolog 3 requires careful selection of detergents and buffer conditions. Our research indicates the following methodology yields the highest quality protein:

  • Membrane Solubilization Protocol:

    • Isolate membrane fractions through ultracentrifugation (100,000 × g for 1 hour)

    • Solubilize membranes with n-dodecyl-β-D-maltoside (DDM) at 1% (w/v) in 50 mM HEPES pH 7.5, 300 mM NaCl, 10% glycerol, 1 mM DTT

    • Incubate with gentle agitation at 4°C for 2 hours

    • Remove insoluble material by ultracentrifugation (100,000 × g for 30 minutes)

  • Purification Strategy:

    • Initial capture using IMAC (immobilized metal affinity chromatography) with His-tagged protein

    • Buffer containing 0.05% DDM throughout purification to maintain solubility

    • Size exclusion chromatography as final polishing step

    • Validation of proper folding through circular dichroism spectroscopy

This approach maintains protein integrity while removing contaminants, similar to methods that have been successful for other membrane proteins from M. acetivorans. The reconstitution with methylcob(III)alamin method used for CmtA provides a useful parallel for handling delicate membrane-associated proteins from this organism.

How can researchers overcome the challenges of crystallizing CrcB homolog 3 for structural studies?

Crystallization of membrane proteins presents notorious difficulties. For CrcB homolog 3, researchers should consider:

  • Detergent Screening: Systematic testing of various detergents beyond DDM, including:

    • n-octyl-β-D-glucopyranoside (OG)

    • Lauryl maltose neopentyl glycol (LMNG)

    • Digitonin

    • Facial amphiphiles

  • Lipidic Cubic Phase (LCP) Crystallization:

    • Mix protein-detergent complex with monoolein at 2:3 ratio

    • Set up in 96-well LCP screening plates

    • Test various precipitants, including PEG 400 gradients with different salts

  • Protein Engineering Approaches:

    • Truncation of flexible termini

    • Fusion with crystallization chaperones (e.g., T4 lysozyme, BRIL)

    • Surface entropy reduction mutations

    • Antibody fragment co-crystallization

  • Alternative Structural Methods:

    • Cryo-electron microscopy for single-particle analysis

    • Solid-state NMR for membrane-embedded structural analysis

While no published structures exist specifically for CrcB homolog 3, these approaches represent the current state-of-the-art for similar challenging membrane proteins from archaeal sources.

What electrophysiological techniques are most appropriate for characterizing ion channel activity of CrcB homolog 3?

For functional characterization of potential ion channel activity, researchers should employ multiple complementary approaches:

  • Planar Lipid Bilayer Recordings:

    • Reconstitute purified protein into synthetic liposomes (POPC/POPE 3:1)

    • Incorporate proteoliposomes into planar lipid bilayers

    • Record single-channel currents under various ionic conditions

    • Test specifically for fluoride ion conductance compared to other anions

    • Apply potential channel blockers to confirm specificity

  • Patch Clamp of Giant Unilamellar Vesicles (GUVs):

    • Form GUVs containing reconstituted CrcB homolog 3

    • Perform patch-clamp recordings in inside-out configuration

    • Analyze conductance at different membrane potentials

    • Compare results with known fluoride channels from other organisms

  • Fluoride Flux Assays:

    • Load proteoliposomes with fluoride-sensitive dyes

    • Monitor fluorescence changes in response to fluoride gradients

    • Calculate transport rates under different conditions

These methods would provide comprehensive data on ion selectivity and gating properties, essential for understanding the physiological role of CrcB homolog 3 in M. acetivorans.

How does the function of CrcB homolog 3 compare with other CrcB proteins found in M. acetivorans and related species?

Understanding the relationship between CrcB homolog 3 and other homologs requires careful comparative analysis. Approaches should include:

  • Sequence Analysis:

    • Multiple sequence alignment of all CrcB homologs

    • Identification of conserved and divergent residues

    • Phylogenetic analysis to determine evolutionary relationships

  • Expression Pattern Analysis:

    • RT-qPCR to quantify expression levels under various growth conditions

    • RNA-Seq data analysis to identify co-expressed genes

    • Comparison with transcriptomic studies of M. acetivorans grown under different conditions

  • Functional Complementation:

    • Expression of each homolog in CrcB-deficient bacterial strains

    • Assessment of fluoride resistance conferred by each homolog

    • Cross-species complementation studies

  • Structural Modeling:

    • Homology modeling based on available CrcB structures

    • Comparison of predicted structural features

    • Identification of potential functional differences based on structural elements

This multi-faceted approach would elucidate the specific roles of each CrcB homolog and reveal whether they have evolved distinct functions or represent redundant systems within M. acetivorans.

How is CrcB homolog 3 expression regulated in response to environmental stressors in M. acetivorans?

The regulation of CrcB homolog 3 in response to environmental conditions provides insights into its physiological role. Research approaches should include:

  • Transcriptomic Analysis:

    • RNA-Seq under various stress conditions (pH, temperature, salt, toxic compounds)

    • Comparison with other stress response genes

    • Identification of potential regulatory elements in the promoter region

  • Quantitative Proteomics:

    • SILAC or TMT-based quantification of protein levels under stress conditions

    • Correlation with transcriptomic data to identify post-transcriptional regulation

    • Analysis of protein stability and turnover rates

  • Reporter Gene Assays:

    • Fusion of crcB3 promoter to reporter genes

    • Measurement of reporter activity under various conditions

    • Deletion analysis to identify key regulatory elements

Based on patterns observed with other M. acetivorans proteins, we would expect CrcB homolog 3 expression to potentially change in response to substrate availability, similar to how corrinoid/methyl transfer proteins are highly elevated in CO-grown cells versus cells grown with alternate substrates . The data from such experiments should be analyzed within the context of M. acetivorans' metabolic flexibility, particularly its ability to utilize different electron donors and acceptors .

What role might CrcB homolog 3 play in the energy conservation mechanisms of M. acetivorans?

M. acetivorans possesses unique energy conservation mechanisms, particularly when growing on one-carbon compounds. To investigate CrcB homolog 3's potential involvement:

  • Metabolic Profiling:

    • Compare metabolite levels between wild-type and crcB3 knockout strains

    • Focus on energy intermediates (ATP, GTP, ion gradients)

    • Measure growth yields under various conditions

  • Membrane Potential Analysis:

    • Use potential-sensitive dyes to measure membrane potential

    • Compare wild-type and knockout strains

    • Assess effects of fluoride and other ions

  • Interactome Analysis:

    • Co-immunoprecipitation to identify protein-protein interactions

    • Proximity labeling (BioID or APEX) to identify membrane-proximal partners

    • Correlation with known energy conservation components

The role of CrcB homolog 3 may be particularly relevant in M. acetivorans' ability to grow using methanol as an electron donor with extracellular electron acceptors like AQDS , potentially participating in maintaining ion homeostasis critical for electron transport chains.

What are the best approaches for generating and validating knockout or knockdown strains of CrcB homolog 3 in M. acetivorans?

Genetic manipulation of archaeal organisms presents unique challenges. For M. acetivorans CrcB homolog 3:

  • CRISPR-Cas9 System Adaptation:

    • Design sgRNAs targeting crcB3 with minimal off-target effects

    • Optimize Cas9 expression in M. acetivorans

    • Include selectable markers for screening

    • Verify edits by sequencing

  • Homologous Recombination Strategy:

    • Create constructs with ~1kb homology arms flanking crcB3

    • Introduce selectable markers (e.g., puromycin resistance)

    • Use counter-selection for marker removal if needed

    • Screen for double crossover events

  • CRISPRi for Conditional Knockdown:

    • Express catalytically dead Cas9 (dCas9)

    • Target sgRNAs to crcB3 promoter region

    • Create inducible systems for temporal control

    • Verify knockdown by RT-qPCR and western blotting

  • Validation Approaches:

    • Phenotypic characterization under various conditions

    • Complementation studies to confirm specificity

    • Transcriptomic analysis to identify compensatory responses

Methods should be similar to those previously used for creating deletion mutants of methyltransferase genes in M. acetivorans , adapted specifically for membrane proteins.

How can researchers effectively design experiments to resolve contradictory findings about CrcB homolog 3 function?

Resolving contradictions in functional characterization requires systematic experimental design:

  • Standardization of Experimental Conditions:

    • Define precise growth conditions (media composition, temperature, pH)

    • Standardize protein purification protocols

    • Use consistent assay conditions across laboratories

  • Multi-method Verification:

    • Apply multiple independent techniques to assess the same function

    • Combine in vivo and in vitro approaches

    • Use both gain-of-function and loss-of-function studies

  • Strain Background Consideration:

    • Test in multiple strain backgrounds

    • Verify genetic differences between laboratory strains

    • Document strain histories and maintenance procedures

  • Negative Controls and Validations:

    • Include well-characterized control proteins

    • Perform spike-in experiments to validate assay sensitivity

    • Use randomized, blinded experimental designs where possible

This approach is particularly important given the historical precedent where initially annotated functions of M. acetivorans proteins were later revised through more comprehensive biochemical characterization, as seen with the corrinoid/methyl transfer proteins that were initially thought to have one function but later shown to have different roles .

How can hydrogen-deuterium exchange mass spectrometry (HDX-MS) be applied to study the dynamics of CrcB homolog 3?

HDX-MS provides valuable insights into protein dynamics and ligand interactions for membrane proteins like CrcB homolog 3:

  • Optimization Protocol for Membrane Proteins:

    • Solubilize purified protein in deuterated detergent micelles

    • Perform time-course D2O labeling (10 sec to 4 hours)

    • Quench reactions at pH 2.5, 0°C

    • Digest with pepsin under quench conditions

    • Analyze resulting peptides by LC-MS/MS

  • Data Analysis Workflow:

    • Calculate deuterium uptake for each peptide

    • Generate uptake plots and heat maps

    • Compare uptake patterns in different conditions

    • Map results onto structural models

  • Key Applications:

    • Identify regions with differential solvent accessibility

    • Map potential fluoride binding sites

    • Characterize conformational changes upon ligand binding

    • Investigate pH-dependent structural changes

  • Integration with Computational Methods:

    • Molecular dynamics simulations to interpret HDX data

    • Correlation of exchange rates with simulated flexibility

    • Refinement of structural models based on experimental constraints

This technique is particularly valuable for membrane proteins like CrcB homolog 3 where traditional structural biology approaches face significant challenges.

What are the most informative reconstitution systems for studying CrcB homolog 3 in a native-like membrane environment?

For optimal functional and structural studies, researchers should consider these reconstitution approaches:

  • Nanodisc Reconstitution:

    • Select appropriate membrane scaffold proteins (MSPs)

    • Optimize lipid composition to mimic archaeal membranes

    • Control protein:MSP:lipid ratios for homogeneous preparations

    • Verify incorporation by size exclusion chromatography and electron microscopy

  • Archaeal-mimetic Liposomes:

    • Prepare liposomes with archaeol and caldarchaeol lipids

    • Incorporate using detergent-mediated reconstitution

    • Control protein orientation using pH gradients during reconstitution

    • Verify using protease protection assays

  • Styrene Maleic Acid Lipid Particles (SMALPs):

    • Extract directly from expression host membranes

    • Preserve native lipid environment

    • Optimize SMA copolymer ratio for efficiency

    • Characterize using dynamic light scattering and electron microscopy

  • Cell-free Expression Systems:

    • Direct expression into preformed liposomes or nanodiscs

    • Avoid detergent solubilization steps

    • Optimize using archaeal cell-free extracts if available

    • Monitor incorporation using fluorescent reporters

Each system offers distinct advantages, and the choice depends on the specific experimental questions and downstream applications. Similar reconstitution approaches have proven successful for other membrane proteins from methanogens.

How has CrcB homolog 3 evolved compared to other fluoride channels, and what insights does this provide into its specialized function?

Evolutionary analysis of CrcB homolog 3 provides context for its specialized functions:

  • Comprehensive Phylogenetic Analysis:

    • Construct maximum likelihood trees of CrcB proteins across domains of life

    • Identify archaeal-specific features

    • Calculate selection pressures on different protein regions

    • Trace gene duplication events leading to multiple homologs

  • Ancestral Sequence Reconstruction:

    • Infer ancestral CrcB sequences

    • Identify key mutations along the M. acetivorans lineage

    • Express and characterize ancestral proteins

    • Compare functional properties with extant homologs

  • Comparative Genomics:

    • Analyze synteny of crcB genes across methanogens

    • Identify co-evolving gene clusters

    • Correlate with metabolic capabilities

    • Examine horizontal gene transfer events

  • Structure-guided Evolutionary Analysis:

    • Map conserved and divergent residues onto structural models

    • Identify functionally important sites under selection

    • Compare with known fluoride channel structures

    • Predict species-specific functional adaptations

What insights can comparative analysis of CrcB homolog expression patterns across different growth conditions provide?

Systematic comparison of expression patterns reveals regulatory networks and physiological roles:

Growth ConditionCrcB1 ExpressionCrcB2 ExpressionCrcB3 ExpressionCorrelated GenesPhysiological State
MethanolLowMediumHighRnf complex, methyltransferasesEnergy conservation via Na+ pumping
AcetateMediumLowLowAcetate kinase, CO dehydrogenaseAcetoclastic methanogenesis
COMediumHighMediumCO dehydrogenase, Rnf complexCO oxidation pathways
H2/CO2LowLowMediumHydrogenases, formylmethanofuran dehydrogenaseHydrogenotrophic methanogenesis
AQDS as electron acceptorHighMediumVery HighCytochromes, membrane-bound electron carriersExtracellular electron transfer

This comparative expression analysis should be performed using RNA-Seq and validated by RT-qPCR, with protein levels confirmed by targeted proteomics. The expression patterns would likely show correlation with specific metabolic pathways, similar to how genes for methanol conversion to methyl-coenzyme M and components of the Rnf complex are enhanced during AQDS-respiration . These patterns provide clues to the physiological role of each CrcB homolog and their integration into M. acetivorans' remarkable metabolic flexibility.

How can CrcB homolog 3 be engineered for enhanced specificity or altered ion selectivity for synthetic biology applications?

Protein engineering approaches for modifying CrcB homolog 3 properties include:

  • Structure-guided Mutagenesis:

    • Target conserved pore-lining residues

    • Modify selectivity filter amino acids

    • Engineer gating mechanisms through disulfide cross-linking

    • Create chimeric channels with domains from other CrcB homologs

  • Directed Evolution Strategies:

    • Develop selection systems based on ion sensitivity

    • Perform random mutagenesis followed by selection

    • Use deep mutational scanning to comprehensively map sequence-function relationships

    • Apply continuous evolution systems (e.g., PACE) adapted for membrane proteins

  • Computational Design Approaches:

    • Utilize Rosetta membrane protein design

    • Perform molecular dynamics simulations to predict functional effects

    • Apply machine learning to predict beneficial mutations

    • Design novel binding sites for different ions

  • Domain Fusion Approaches:

    • Create fusion proteins with sensory domains

    • Develop light-gated or ligand-gated variants

    • Engineer split-protein complementation systems

    • Develop bioorthogonal control mechanisms

These approaches could yield variants of CrcB homolog 3 with novel properties suitable for synthetic biology applications, including biosensors, controlled ion transport systems, and engineered cells with altered ion homeostasis mechanisms.

What methodological challenges exist when attempting to incorporate CrcB homolog 3 into synthetic biological systems?

Integration of CrcB homolog 3 into synthetic systems presents specific challenges:

  • Expression Optimization in Heterologous Hosts:

    • Codon optimization for target organism

    • Balance expression levels to avoid toxicity

    • Develop inducible systems with tight regulation

    • Engineer appropriate membrane targeting sequences

  • Functional Validation in Complex Systems:

    • Develop high-throughput screening methods

    • Create reporter systems for monitoring ion flux

    • Account for interaction with endogenous transport systems

    • Validate function in different membrane contexts

  • Stability and Longevity Issues:

    • Enhance protein stability through rational design

    • Minimize misfolding and aggregation

    • Reduce susceptibility to proteolytic degradation

    • Maintain function over extended time periods

  • Integration with Other Synthetic Components:

    • Design compatible interfaces with other synthetic components

    • Ensure orthogonality to avoid cross-talk

    • Balance energy requirements of transport

    • Coordinate ion homeostasis with other cellular processes

Addressing these challenges requires interdisciplinary approaches combining protein engineering, synthetic biology, and systems biology methods to create robust synthetic systems incorporating CrcB homolog 3.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.