Recombinant Methanosarcina acetivorans Tetrahydromethanopterin S-methyltransferase subunit B (mtrB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Methanosarcina acetivorans Tetrahydromethanopterin S-Methyltransferase Subunit B (mtrB)

Methanosarcina acetivorans is a methanogenic archaeon capable of metabolizing diverse substrates, including methanol, methylamines, acetate, and carbon monoxide (CO). The Mtr complex, a multi-subunit methyltransferase system, plays a central role in transferring methyl groups from methylated substrates to coenzyme M (CoM) during methanogenesis. mtrB is one of the subunits within this complex, specifically involved in the catalytic transfer of methyl groups from methylated tetrahydromethanopterin (H₄MPT) to CoM. The recombinant form of mtrB, expressed in Escherichia coli with an N-terminal His-tag, has been characterized for its biochemical properties and functional roles in methanogenesis .

3.1. Catalytic Activity

mtrB operates as part of the MtrEDCBAFGH complex, which facilitates the transfer of methyl groups from methylated H₄MPT to CoM. This step is critical for generating methyl-CoM, a precursor for methane synthesis via the methanogenic pathway .

Key Functions:

  1. Methyl Transfer: Catalyzes the reaction:

    CH3-H4MPT+HS-CoMH4MPT+CH3-S-CoM\text{CH}_3\text{-H}_4\text{MPT} + \text{HS-CoM} \rightarrow \text{H}_4\text{MPT} + \text{CH}_3\text{-S-CoM}
  2. Electron Transport: Integrates with membrane-bound complexes (e.g., HdrED) for energy conservation .

3.2. Regulatory Dynamics

  • Downregulation: Expression of mtr operon genes (MA0269–MA0276) is suppressed during CO-dependent growth, suggesting substrate-specific regulation .

  • Essentiality: Deletion of the mtr operon (ΔmtrEDCBAFGH) renders M. acetivorans unable to grow on methanol or CO alone, highlighting its irreplaceable role in methylotrophic and carboxidotrophic pathways .

4.1. MtrB in Methanogenic Pathways

  • Methylotrophic Methanogenesis: mtrB is indispensable for converting methanol to methane. Mutants lacking mtrB cannot bypass this step via alternative pathways (e.g., methyl sulfide-dependent systems) .

  • CO Metabolism: In CO-grown cells, mtrB abundance decreases, but residual activity supports minimal methane production .

Experimental Data:

StrainSubstrateMethane ProductionGrowth OutcomeSource
Wild-typeMethanolHighViability
ΔmtrMethanolNoneNo growth
Δmtr + MeOHCOLowLimited growth

4.2. Proteomic and Transcriptional Analysis

  • Protein Abundance: mtrB levels correlate with methanol/CO utilization. In CO-grown cells, mtrB expression drops, while McrABG (methyl-coenzyme M reductase) remains stable .

  • Transcriptional Regulation: The mtr operon is co-regulated with other methyltransferase genes (e.g., mtaCB1) under methanol-specific regulators (MsrA/B) .

5.1. Metabolic Engineering

  • Acetogenic Strains: Deletion of mtr shifts M. acetivorans toward acetogenesis, producing acetate from CO. This has implications for biofuel production .

  • Methylotrophic Enhancements: Overexpression of mtrB or related methyltransferases could improve methane yields from methanol .

5.2. Mechanistic Studies

  • Redox Sensing: The thioredoxin system (TrxR/Trx7) in M. acetivorans reduces disulfide bonds in regulatory proteins, potentially modulating mtrB activity under oxidative stress .

6.1. Unresolved Questions

  • Alternative Pathways: Despite claims of Mtr bypass mechanisms, experimental evidence confirms mtrB’s necessity in methylotrophic methanogenesis .

  • Structural Elucidation: High-resolution crystal structures of the Mtr complex remain elusive, limiting mechanistic insights.

6.2. Potential Innovations

  • Cofactor Engineering: Enhancing cofactor regeneration (e.g., via Rnf or Hdr complexes) could improve energy efficiency in mtrB-dependent pathways .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery estimations, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your preparations.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please let us know, and we will prioritize its development.
Synonyms
mtrB; MA_0273; Tetrahydromethanopterin S-methyltransferase subunit B; N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Target Names
mtrB
Target Protein Sequence
MSMIRIAPEVHLVMDPDTAVVAEEREDSILYSMDPVFERMDKLDGIAEDLLNSLSPSKPL LNSWPGRENTSYMAGIYGNAFYGIVVGLAFSGLLALIIFIQRLIEGGM
Uniprot No.

Target Background

Function
This protein is part of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This process is an energy-conserving, sodium-ion translocating step.
Database Links

KEGG: mac:MA_0273

STRING: 188937.MA0273

Protein Families
MtrB family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the functional role of the Mtr complex in methanogenic pathways?

The Mtr complex plays a critical role in methanogenesis by catalyzing the transfer of the methyl group from N5-methyltetrahydromethanopterin (CH3-H4MPT) to coenzyme M (H-S-CoM), forming methyl-coenzyme M as a key intermediate in methanogenesis. This exergonic methyl transfer reaction is coupled with energy conservation through the electrogenic translocation of sodium ions across the cytoplasmic membrane. The membrane-associated nature of this complex enables it to contribute to establishing electrochemical gradients that can be utilized for ATP synthesis. In Methanosarcina acetivorans specifically, the Mtr complex is required for growth on various substrates including methylated compounds, acetate, and carbon monoxide, which are metabolized via distinct yet overlapping pathways .

How do researchers differentiate between MtrB and other Mtr subunits in experimental design?

When designing experiments to study MtrB specifically, researchers must employ multiple strategies to differentiate it from other Mtr subunits. First, genetic approaches can be used to introduce epitope tags or fluorescent markers specifically to the mtrB gene using the Cas9-mediated genome editing techniques that have been successfully implemented in M. acetivorans . This allows for targeted immunoprecipitation and visualization. Second, researchers can design specific primers for quantitative PCR to measure mtrB expression levels distinct from other subunits. Third, proteomic approaches using mass spectrometry can identify peptide fragments unique to MtrB. Finally, by creating conditional knockdown strains using the promoter-RBS library systems available for M. acetivorans (which provides a 140-fold dynamic range between weakest and strongest promoter combinations), researchers can specifically modulate mtrB expression and observe resulting phenotypic changes in methyl transfer activity and energy conservation .

What Cas9-based strategies can be used for targeted modification of the mtrB gene?

The Cas9-mediated genome editing system established for Methanosarcina acetivorans provides a streamlined approach for introducing targeted modifications to the mtrB gene. This system utilizes a Cas9-sgRNA complex that generates double-strand breaks (DSBs) at specific target sites within the mtrB sequence. These breaks are then repaired through either homology-dependent repair or nonhomologous end-joining machinery present in archaea . The methodology involves designing guide RNAs specific to the mtrB genomic region and providing appropriate repair templates with homology arms flanking the desired modification site.

The system also incorporates a counter-selectable marker system using hypoxanthine phosphoribosyltransferase (hpt), which confers sensitivity to the purine analog 8-aza-2,6-diaminopurine (8ADP) in strains lacking the native hpt gene. This facilitates efficient curing of the gene-editing vector after successful introduction of the desired mutation. Experimental validation has shown that 8ADP-resistant clones selected from puromycin-resistant transformants are consistently found to be puromycin-sensitive and contain the intended frameshift mutations, with PCR screening confirming the absence of the editing vector . This approach enables researchers to introduce unmarked mutations in the mtrB gene, allowing for precise genetic manipulation without leaving behind selection markers that might interfere with subsequent analyses.

How can the promoter-RBS library be utilized to optimize recombinant mtrB expression?

The recently developed promoter-RBS library for M. acetivorans provides a sophisticated toolset for fine-tuning mtrB expression to optimal levels. This library consists of 33 promoter-RBS combinations that includes 13 wild-type and 14 hybrid combinations, as well as six combination variants with rationally engineered 5'-untranslated regions (5'UTR). The expression strength of each combination has been thoroughly characterized using a β-glucuronidase reporter gene system in the presence of different growth substrates (methanol and trimethyl amine) .

For optimizing recombinant mtrB expression, researchers should first determine the desired expression level based on their experimental goals. The library provides a 140-fold range between the weakest and strongest promoter-RBS combinations, allowing selection of the appropriate expression level. Additionally, measurements at three distinct growth phases for all 33 combinations provide critical information for timing sample collection for maximum yield. For functional studies requiring near-native expression levels, researchers might select weaker promoter-RBS combinations, while structural studies requiring higher protein yields might benefit from stronger combinations. The substrate-dependent expression patterns revealed in the characterization of this library also suggest that researchers should consider the growth substrate when selecting the optimal promoter-RBS combination for their specific experimental conditions .

What approaches can be used to analyze the effects of mtrB mutations on methanogenesis pathways?

Analysis of mtrB mutations on methanogenesis pathways requires a multifaceted experimental approach. First, researchers can measure methane production rates using gas chromatography to quantify the direct impact of specific mtrB mutations on methanogenesis output. This should be performed using different methanogenic substrates (methanol, trimethylamine, acetate, and carbon monoxide) since M. acetivorans can metabolize these via distinct yet overlapping pathways .

Second, isotopic labeling experiments using 13C-labeled substrates can trace the flow of carbon through methanogenic pathways and identify potential metabolic bottlenecks or redirections caused by mtrB mutations. Previous research has shown that conversion of [13C]methanol in M. acetivorans provides insights into how reducing equivalents are generated for methyl-S-CoM reduction to methane .

Third, membrane potential measurements using voltage-sensitive dyes can assess whether mtrB mutations affect the sodium ion translocation function of the Mtr complex, which is crucial for energy conservation. Additionally, transcriptomic and proteomic analyses can reveal compensatory changes in expression of other methanogenesis genes in response to mtrB mutations, providing a systems-level understanding of pathway adjustments. These approaches together provide a comprehensive analysis of how specific mtrB mutations impact the complex methanogenesis pathways in M. acetivorans.

What assays can be used to measure the methyltransferase activity of recombinant mtrB within the Mtr complex?

Measuring the methyltransferase activity of the Mtr complex containing recombinant mtrB requires specialized assays that account for the membrane-associated nature of the complex and its coupling to energy conservation. A direct approach involves monitoring the transfer of methyl groups from N5-methyltetrahydromethanopterin to coenzyme M. This can be achieved using either radiolabeled substrates (3H or 14C-labeled methyltetrahydromethanopterin) or by coupling the reaction to subsequent enzymatic steps and measuring changes in absorbance or fluorescence.

For detailed kinetic characterization, researchers can use stopped-flow spectrophotometry to measure the rate of methylcob(I)alamin formation on the MtrA subunit, which interacts with mtrB in the complex. This approach monitors changes in the absorption spectrum as the corrinoid cofactor of MtrA transitions between different methylation and oxidation states. Additionally, because the Mtr complex couples methyl transfer to sodium ion translocation, researchers can assess mtrB function by measuring sodium ion movements using sodium-selective electrodes or fluorescent sodium indicators in reconstituted proteoliposomes containing the Mtr complex. The rate of sodium translocation relative to methyl group transfer provides valuable information about the efficiency of energy coupling and how mtrB might contribute to this process .

How can researchers investigate substrate specificity differences caused by mtrB variants?

Investigating substrate specificity differences in mtrB variants requires systematic comparison of activity with different substrates under standardized conditions. A comprehensive approach should include:

  • Steady-state kinetic analysis: Determine Km and Vmax values for methyltetrahydromethanopterin and coenzyme M with each mtrB variant. This reveals changes in substrate binding affinity and catalytic efficiency.

  • Substrate competition assays: Measure activity with the primary substrate in the presence of structural analogs to determine substrate selectivity profiles for different mtrB variants.

  • Growth substrate comparisons: Analyze growth rates and methane production of M. acetivorans strains expressing mtrB variants when cultured on different substrates (methanol, trimethylamine, acetate, or carbon monoxide). The differential growth profiles can reveal substrate-specific effects of mtrB mutations .

  • Isotopic labeling: Use isotopically labeled substrates (13C or deuterium) combined with mass spectrometry to track substrate flux through the methanogenesis pathway in strains expressing different mtrB variants.

These approaches together can provide a detailed picture of how specific amino acid changes in mtrB affect the substrate specificity of the Mtr complex, potentially revealing the structural basis for substrate recognition and binding.

What experimental designs can resolve contradictions in mtrB functional data?

When faced with contradictory data in mtrB functional studies, researchers should employ a systematic approach to resolve inconsistencies. First, careful data preprocessing is essential to examine whether observed contradictions result from measurement errors, recording errors, or outliers. The aim should be to analyze the impact of data contradiction on the model rather than simply removing all contradictory data points .

Second, researchers should categorize the types of contradictions encountered. As demonstrated in materials science research, contradictions can manifest as either different output values with identical input variables (type 1) or identical output values with different input variables (type 2). Understanding the nature of the contradiction helps guide resolution strategies .

Third, employing multiple analytical approaches to model the same data can provide robust insights despite contradictions. Decision trees algorithm (DT) and rough sets algorithm (RST) have been shown effective for modeling contradictory data, revealing underlying patterns that might be obscured by inconsistencies .

Finally, experimental designs should incorporate multiple replicates, varied methodologies, and cross-validation approaches. For example, if contradictory results emerge from activity assays, researchers should verify findings using both in vitro biochemical assays and in vivo genetic complementation studies. By synthesizing evidence across multiple experimental approaches, a more coherent understanding of mtrB function can emerge despite initial data contradictions.

How do structural features of mtrB contribute to ion translocation in the Mtr complex?

The structural features of mtrB that contribute to ion translocation remain an area of active investigation, though considerable insights can be derived from similar energy-conserving membrane complexes. Based on the established role of the Mtr complex in coupling methyl transfer to sodium ion translocation across the cytoplasmic membrane, mtrB likely contains transmembrane helices that form part of the ion channel or transport pathway. These transmembrane domains would contain charged or polar residues positioned to facilitate the coordinated movement of sodium ions in response to conformational changes triggered by the methyl transfer reaction.

Analysis of the eight-subunit Mtr complex suggests a mechanism similar to other ion-translocating enzymes, where energy released from the exergonic methyl transfer reaction drives conformational changes that alter the accessibility of ion binding sites, creating a pathway for directed ion movement across the membrane. The corrinoid-containing MtrA subunit undergoes methylation and demethylation during the catalytic cycle, with a histidine residue serving as the axial ligand to cobalt in certain oxidation states . These chemical changes likely propagate structural rearrangements to associated subunits including mtrB, altering the conformation of ion-coordinating residues to facilitate directional sodium transport. Detailed structural studies using cryo-electron microscopy or X-ray crystallography would be required to fully elucidate the precise mechanism.

What conserved domains in mtrB are critical for interaction with other Mtr subunits?

While the specific conserved domains in mtrB that mediate interactions with other Mtr subunits are not explicitly detailed in the available search results, general principles of protein-protein interactions in multisubunit complexes suggest several potentially critical regions. Interface domains between mtrB and other subunits likely contain conserved hydrophobic residues that facilitate tight packing, as well as polar or charged residues that form specific hydrogen bonds or salt bridges to ensure proper orientation and assembly.

The interaction between mtrB and MtrA may be particularly important given MtrA's central role in carrying the corrinoid prosthetic group that becomes methylated and demethylated during catalysis . This interaction would need to position the corrinoid cofactor optimally relative to the ion translocation pathway, suggesting conserved binding motifs in mtrB that recognize specific structural elements of MtrA.

Similarly, the interaction between mtrB and MtrH (which catalyzes the methylation reaction) would be critical for coupling the chemical and ion transport activities of the complex. MtrH shows sequence similarity to known methyltransferases like MetH from Escherichia coli and AcsE from Clostridium thermoaceticum , suggesting that mtrB might contain domains that evolved to specifically interact with this ancient and conserved enzyme family.

How do post-translational modifications affect mtrB function within the complex?

Post-translational modifications (PTMs) of mtrB likely play significant roles in regulating its function within the Mtr complex, though specific modifications have not been characterized in detail in the available search results. In membrane-associated multienzyme complexes involved in energy conservation, common PTMs include phosphorylation, methylation, acetylation, and various redox modifications of cysteine residues.

Phosphorylation of mtrB could regulate its interaction with other subunits or modulate the efficiency of ion translocation in response to cellular energy state. The coupling between methyl transfer and ion movement might be fine-tuned through reversible modifications that alter the conformation or electrostatic properties of ion-coordinating residues within mtrB.

Additionally, in anaerobic methanogens like M. acetivorans, the redox state of the environment could influence PTMs of mtrB, particularly modifications of cysteine residues such as S-thiolation or formation of disulfide bonds. These modifications could serve as regulatory switches that adjust the activity of the Mtr complex in response to changes in redox conditions or substrate availability.

To investigate these modifications, researchers would need to employ mass spectrometry-based proteomic approaches to identify the types and locations of PTMs on mtrB, followed by site-directed mutagenesis to replace modified residues and assess the functional consequences on methyl transfer activity and ion translocation efficiency.

How can recombinant mtrB be utilized in synthetic biology applications for methane bioengineering?

Recombinant mtrB holds significant potential for synthetic biology applications aimed at methane bioengineering. By leveraging the newly developed promoter-RBS library with its 140-fold dynamic range of expression strength, researchers can precisely control mtrB expression levels to optimize methane production or consumption pathways . This fine-tuning capability is particularly valuable for metabolic engineering projects that aim for the biotechnological valorization of one-carbon compounds.

One promising application involves engineering M. acetivorans strains with modified mtrB to enhance methane production from waste carbon sources. By optimizing the efficiency of the methyl transfer process and its coupling to energy conservation, researchers could develop more effective bioreactors for converting organic waste to methane for use as a renewable fuel source. Alternatively, engineered Mtr complexes containing modified mtrB could be designed to reverse the methanogenic pathway, consuming methane and converting it to liquid fuels or chemical precursors.

The eight-subunit composition of the Mtr complex also presents opportunities for creating chimeric systems that combine subunits from different methanogenic species, potentially expanding substrate ranges or improving catalytic efficiency. Such engineered Mtr complexes could be expressed in non-methanogenic hosts to introduce novel metabolic capabilities into industrial microorganisms .

What are the implications of mtrB research for understanding primordial energy conservation mechanisms?

Research on mtrB and the Mtr complex provides valuable insights into primordial energy conservation mechanisms that may have been present in early life forms. The methyltetrahydromethanopterin:coenzyme M methyltransferase complex represents one of the most ancient forms of energy conservation through ion translocation coupled to methyl transfer reactions. Understanding the structure-function relationships in mtrB can illuminate how early biological systems evolved to capture and conserve energy in anaerobic environments.

The search results reveal intriguing evolutionary connections, such as the sequence similarity between MtrH and methyltransferases found in bacteria (MetH from E. coli and AcsE from C. thermoaceticum) . This suggests ancient evolutionary relationships that span across domains of life and points to the possibility that the methyl transfer mechanisms coupled to energy conservation may have emerged early in the evolution of life, potentially even predating the divergence of Bacteria and Archaea.

Moreover, evidence for horizontal and vertical transmission of Mtr-mediated processes suggests that these energy conservation mechanisms have been distributed through evolution by multiple routes . Detailed characterization of mtrB from diverse methanogenic archaea could reveal how this energy conservation system adapted to different environmental niches throughout Earth's history, providing a window into the evolution of bioenergetic systems from the earliest metabolic pathways to the sophisticated energy transduction mechanisms found in contemporary organisms.

How can data from contradictory experimental results with mtrB be reconciled using mathematical modeling?

When faced with contradictory experimental results in mtrB studies, mathematical modeling offers powerful approaches for data reconciliation. The first step involves careful data preprocessing to examine whether contradictions stem from measurement errors, recording errors, or genuine biological variability . Rather than simply discarding contradictory data points, researchers should analyze how these contradictions affect the modeling process.

Rule-based modeling methods such as decision trees algorithm (DT) and rough sets algorithm (RST) have proven effective for handling contradictory data. These approaches can identify patterns and relationships even when observations contain inconsistencies. For example, data might show 34 pairs of contradictory observations where different values of the output variable occur with the same input variables (type 1 contradiction), or 206 pairs where observations differ in one input variable value but yield the same output value (type 2 contradiction) . These patterns can provide insights into which variables most strongly influence mtrB function.

For more complex models, ensemble methods that combine multiple modeling approaches can be particularly robust when dealing with contradictory data. By integrating predictions from diverse models trained on different subsets of the data, researchers can develop more reliable predictions that account for inconsistencies. Bayesian approaches are especially valuable, as they explicitly incorporate uncertainty into the modeling framework, allowing researchers to quantify confidence in predictions despite contradictory experimental results.

The table below illustrates how contradictory data might be organized for mathematical modeling:

Experiment IDmtrB VariantTemperature (°C)SubstrateIncubation Time (min)Activity (%)
1801Wild-type871MeOH9023.3
1802Wild-type871MeOH9021.4
1803Wild-type871TMA9021.4
1804Wild-type871TMA12021.3

In this example, experiments 1801 and 1802 represent type 1 contradictions (same conditions, different activities), while 1803 and 1804 represent type 2 contradictions (different incubation times, nearly identical activities) .

How does mtrB from Methanosarcina acetivorans compare to homologous proteins in other methanogenic archaea?

In the broader context of methyltransferase evolution, the search results indicate that MtrH shows sequence similarity to methyltransferases found in bacteria, specifically MetH from Escherichia coli and AcsE from Clostridium thermoaceticum . This suggests ancient evolutionary relationships that span across domains of life. Similarly, mtrB likely shares structural and functional features with related subunits in other organisms, while containing unique adaptations specific to the Methanosarcina genus.

A comprehensive phylogenetic analysis of mtrB sequences across diverse methanogens would likely reveal patterns of vertical inheritance within lineages, punctuated by horizontal gene transfer events that have contributed to the distribution of these energy conservation mechanisms across different archaeal groups.

What insights can be gained from studying mtrB in the context of horizontal gene transfer among archaea?

Studying mtrB in the context of horizontal gene transfer (HGT) among archaea offers valuable insights into the evolution and distribution of energy conservation mechanisms. The search results provide evidence for both horizontal and vertical transmission of Mtr-mediated processes , suggesting that these important energy conservation systems have spread through archaeal lineages by multiple evolutionary routes.

HGT analysis of mtrB sequences from diverse archaea could reveal instances where this gene has moved between distantly related lineages, potentially conferring new metabolic capabilities to the recipient organisms. Such transfer events might be identified through incongruences between mtrB phylogenies and species phylogenies, anomalous GC content or codon usage patterns in certain mtrB sequences, or the presence of flanking mobile genetic elements.

The distribution of mtrB across archaeal lineages may also provide insights into the environmental and ecological factors that drive HGT of energy conservation mechanisms. For example, methanogens that occupy similar ecological niches despite being phylogenetically distant might show evidence of HGT for mtrB, reflecting convergent adaptation to similar energy landscapes.

Furthermore, studying the patterns of HGT in the mtr gene cluster could illuminate how multisubunit enzyme complexes evolve and diversify. The modular nature of the Mtr complex might allow for subunit-specific HGT events, potentially leading to chimeric complexes with novel properties. Understanding these evolutionary dynamics could inform strategies for engineering synthetic Mtr complexes with enhanced capabilities for biotechnological applications .

How have genome editing techniques improved our understanding of mtrB function in methanogenic pathways?

The development of advanced genome editing techniques, particularly Cas9-mediated systems, has revolutionized our understanding of mtrB function in methanogenic pathways. The Cas9-mediated genome editing approach for Methanosarcina acetivorans described in the search results addresses a major constraint in methanogen research by streamlining the mutagenic process and enabling simultaneous introduction of multiple mutations .

This technical advancement has allowed researchers to generate precise mutations in the mtrB gene, ranging from single amino acid substitutions to domain deletions or complete gene knockouts. Such targeted genetic manipulations have helped elucidate the specific roles of mtrB in the Mtr complex and its contributions to methyl transfer and energy conservation. The ability to introduce unmarked mutations is particularly valuable, as it allows for the creation of strains with multiple sequential modifications without accumulating selection markers that might interfere with cellular physiology.

The counter-selectable marker system using hypoxanthine phosphoribosyltransferase (hpt) enables efficient curing of gene-editing vectors after successful mutation, facilitating the construction of complex genotypes through sequential editing steps . This capability has allowed researchers to systematically dissect the functions of different domains within mtrB and to investigate its interactions with other Mtr subunits in vivo.

Combined with the promoter-RBS library that provides precise control over gene expression levels , these genome editing techniques have enabled unprecedented manipulation of mtrB expression and function. Researchers can now create conditional mutants, tune expression levels across a 140-fold range, and introduce specific mutations to test hypotheses about structure-function relationships in this important component of methanogenic metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.