Recombinant Methanosarcina acetivorans Tetrahydromethanopterin S-methyltransferase subunit C (mtrC)

Shipped with Ice Packs
In Stock

Description

Biochemical Role of MtrC in Methanogenesis

MtrC is part of the Mtr complex, which catalyzes the exergonic transfer of a methyl group from CH3_3-H4_4SPT to CoM, generating CH3_3-CoM and a sodium ion gradient . This step is pivotal in both acetoclastic and methylotrophic methanogenesis. Key features include:

  • Structural Role: MtrC interacts with other subunits (e.g., MtrA, MtrB) to stabilize the membrane-associated complex .

  • Sodium Dependency: The Mtr complex couples methyl transfer to sodium ion translocation, critical for ATP synthesis .

  • Genetic Essentiality: Deletion of mtr operon genes in M. acetivorans abolishes growth on substrates requiring methyl transfer, such as methanol or acetate .

Genetic and Proteomic Insights

Studies of M. acetivorans mutants lacking mtr genes reveal compensatory metabolic adaptations:

Mutant StrainPhenotypeProteomic ChangesSource
Δmtr (MKOmtrSF)Acetogenic growth on CO; abolished methanogenesis↑ Methyltransferase MtpA, MtsF; ↓ HdrD (terminal oxidoreductase)
Δmtr + ΔhdrEDRetained acetogenic growthLoss of HdrED activity; no methane production
Δmtr + ΔmtsNo growth on methanolConfirmed Mts system is not a bypass for Mtr

Proteomic analysis of Δmtr strains shows upregulated methyltransferases (e.g., MtpA, MtsF) and downregulated respiratory chain components, indicating metabolic rerouting .

Recombinant MtrC: Production and Challenges

While recombinant MtrC from M. acetivorans is not explicitly detailed in current literature, related studies provide context:

  • Expression Systems: M. acetivorans has been engineered to express heterologous proteins (e.g., esterases) via plasmid-based systems . Similar strategies could apply to MtrC.

  • Functional Redundancy: The genome encodes multiple methyltransferases (e.g., MtsD, MtsF), complicating isolation of MtrC-specific activity .

  • Stability Issues: Membrane-associated complexes like Mtr require lipid environments for stability, posing challenges for recombinant production .

Industrial and Research Applications

Recombinant MtrC holds potential for:

  • Biogas Enhancement: Optimizing methane yield in engineered methanogens .

  • Electron Transport Studies: Investigating sodium-coupled energy conservation .

  • Synthetic Biology: Incorporating MtrC into artificial methanogenesis pathways for carbon capture .

Knowledge Gaps and Future Directions

Current limitations include:

  1. Structural Data: No crystal structure exists for M. acetivorans MtrC, hindering mechanistic studies.

  2. Expression Optimization: Robust systems for recombinant MtrC production remain underdeveloped.

  3. Bypass Pathways: The role of cytoplasmic methyltransferases in compensating for Mtr loss requires further exploration .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtrC; MA_0274; Tetrahydromethanopterin S-methyltransferase subunit C; N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Target Names
mtrC
Target Protein Sequence
MSAGGAGGEAKGGFPPQTIMAIGAIGGLAGIYLGNFMPAQFSFFGGLGAICAMVWGADAV RRVASYGLGTGVPSIGMISLGMGIVAALFGLSVGGIAGPIVSFIAAAIIGAVIGVLANKV IGMGIPIMEQAMVEIAGAGTLVIIGLSVVIAGTFDYAEVVEYVVANGYIALIFIIGGMGI LHPFNANLGPDEKQDRTLSVAVEKAAIALIITGFASSLHEGLMAAGLNIAVGVIIWAWAF MKYYGYVKRDSYAVVGTGLLPSAEELE
Uniprot No.

Target Background

Function
This protein is a component of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This reaction constitutes an energy-conserving, sodium-ion translocating step.
Database Links

KEGG: mac:MA_0274

STRING: 188937.MA0274

Protein Families
MtrC family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Tetrahydromethanopterin S-methyltransferase (Mtr) in Methanosarcina acetivorans?

Tetrahydromethanopterin S-methyltransferase (Mtr) serves as a membrane-integral, energy-converting methyltransferase that catalyzes the transfer of a methyl group from N5-methyl-tetrahydrosarcinapterin (H4SPT) to coenzyme M (HS-CoM) during methanogenesis. This reaction represents one of the limited number of chemiosmotic coupling sites in the respiratory chains of methanogenic archaea, making it critical for energy conservation. In Methanosarcina acetivorans specifically, Mtr is required for the metabolism of various substrates including methylated compounds, acetate, and carbon monoxide (CO) . The enzyme is essential for the conversion of these substrates via distinct yet overlapping pathways, highlighting its central role in the organism's metabolic versatility .

What alternative methyltransferase systems exist in M. acetivorans, and how do they relate to Mtr?

M. acetivorans possesses several alternative methyltransferase systems beyond Mtr. Notably, the Mts system (comprising MtsD, MtsF, and MtsH) has been implicated in the metabolism of methylated sulfur compounds. This system was initially proposed as a potential cytoplasmic bypass for Mtr, particularly under carboxydotrophic conditions where Mtr abundance decreases while Mts proteins increase . Other methyltransferase systems in M. acetivorans include the MtpCAP-msrH locus, which is specifically required for methylmercaptopropionate (MMPA) metabolism . Genomic analysis has revealed numerous genes in M. acetivorans that encode MT1/MT2 homologs, including 10 MT1 methyltransferase subunits, 15 MT1 corrinoid subunits, and 13 MT2 proteins, which contribute to the organism's metabolic versatility .

What experimental evidence demonstrates the essentiality of Mtr for methanogenesis in M. acetivorans?

Genetic and physiological studies have conclusively demonstrated that Mtr is essential for methanogenesis in M. acetivorans. When the mtr genes (mtrEDCBAFGH) are deleted, the resulting strains show specific growth defects. For instance, deletion mutants can only grow under certain substrate combinations, such as acetate plus methanol and CO plus methanol, but fail to grow on CO alone . This stands in contrast to previous hypotheses suggesting that M. acetivorans might be able to bypass Mtr via the Mts system. Furthermore, deletion mutants are unable to oxidize methylated substrates to CO2, unlike what has been observed in the related species M. barkeri . These findings collectively establish that despite earlier speculation, no functional in vivo Mtr bypass exists in M. acetivorans, underscoring the enzyme's essential role in the organism's energy metabolism.

How do the electron transfer mechanisms differ between Mtr-dependent and potential Mtr-bypass pathways in methanogenesis?

In the canonical Mtr-dependent pathway, the membrane-integral Mtr complex couples methyl transfer from N5-methyl-H4SPT to HS-CoM with the translocation of sodium ions, thereby contributing to the chemiosmotic gradient for ATP synthesis. Research with Mtr deletion mutants revealed that while these strains can still produce some methane from methylated substrates, they cannot oxidize these substrates to CO2 as wild-type strains do .

The electron transfer mechanisms in these mutants appear to differ fundamentally from the wild-type. Detailed analysis suggests that in Mtr deletion strains, the electrons required for reducing methyl-S-CoM to methane come from oxidizing intracellular compounds to CO2, rather than from disproportionating the methyl groups from the substrate . This represents a significant metabolic rerouting compared to normal methanogenesis.

Protein Expression and Purification

For effective functional analysis of recombinant MtrC, heterologous expression systems must be carefully optimized. While Escherichia coli is commonly used, expression of archaeal membrane proteins often presents challenges due to differences in membrane composition and protein folding machinery. The following methodological approach has proven effective:

  • Controlled expression: Using tightly regulated promoters (e.g., T7 with lac operator) to prevent toxicity from overexpression

  • Fusion tags: Incorporating affinity tags (His6) for purification while adding solubility enhancers (MBP, SUMO) to improve folding

  • Membrane extraction: Sequential solubilization using mild detergents (DDM, LMNG) that maintain native-like membrane environments

For reconstitution studies, MtrC should be incorporated into liposomes or nanodiscs composed of archaeal lipids or synthetic mimics (e.g., POPC/POPE mixtures) to better approximate the native membrane environment .

Functional Assays

Given that MtrC functions as part of a multi-subunit complex, several complementary approaches can assess its functionality:

Assay TypeMethodologyMeasured ParametersAdvantages
Methyl Transfer ActivitySpectrophotometric detection of CoM-S-CH3 formationReaction kinetics (kcat, Km)Direct measure of catalytic activity
Binding StudiesIsothermal titration calorimetryBinding affinity for substrates/cofactorsThermodynamic characterization
Na+ TranslocationpH/ion sensitive fluorophores in proteoliposomesIon transport ratesAssesses energy coupling
Complex AssemblyBlue native PAGE, crosslinking mass spectrometrySubunit interactionsStructural insights

The combination of these approaches provides a comprehensive assessment of MtrC functionality within the context of the complete methyltransferase system .

What mechanisms explain the differential regulation of Mtr versus Mts systems under varying substrate conditions?

The differential regulation of Mtr and Mts systems under varying substrate conditions involves sophisticated transcriptional control mechanisms. Under carboxydotrophic conditions (growth on CO), the abundance of Mtr decreases while the Mts system components (MtsD, MtsF, MtsH) increase . This inverse relationship suggests coordinated regulation responding to substrate availability.

Multiple regulatory mechanisms appear to control this differential expression:

  • Substrate-specific transcriptional regulators: For example, in the MMPA metabolism system, MsrH functions as a transcriptional activator that specifically controls expression of the mtpCAP operon. Mutants lacking msrH fail to transcribe mtpCAP and consequently grow poorly on MMPA medium . Similar substrate-specific regulators likely control Mtr and Mts expression.

  • Energy status sensing: The cellular ATP/ADP ratio changes during growth on different substrates, potentially serving as a signal for modulating expression of energy conservation systems. For instance, during Fe(III)-dependent respiratory growth with acetate, the ATP/ADP ratio doubles, indicating a higher energetic state that could influence gene expression patterns .

  • Environmental sensing: The expression of different methyltransferase systems appears to be influenced by environmental conditions such as substrate concentration. The Acs system in Methanothrix has greater affinity for acetate than the Ack of M. acetivorans, explaining dominance patterns in environments with varying acetate concentrations .

Research examining transcriptomic and proteomic profiles during growth on different substrates would provide further insights into these regulatory mechanisms.

How can genetic complementation strategies be optimized when investigating Mtr subunit functions?

Optimizing genetic complementation strategies for investigating Mtr subunit functions requires careful consideration of several factors:

Expression Vector Design

Effective complementation vectors should:

  • Utilize promoters native to M. acetivorans to ensure physiologically relevant expression levels

  • Incorporate the native ribosome binding site to maintain proper translation efficiency

  • Include sufficient upstream sequence to preserve any regulatory elements

When complementing mtrC specifically, researchers should consider whether to express only mtrC or the entire mtr operon. Evidence suggests that because Mtr functions as a multi-subunit complex, expressing individual subunits may not restore full functionality if proper stoichiometry is disrupted .

Integration Methods and Verification

For stable complementation in M. acetivorans:

  • Site-specific integration: Use the φC31 integrase system to ensure single-copy integration at a neutral site

  • Verification of expression: Confirm protein production via Western blotting with specific antibodies

  • Functional validation: Measure methyltransferase activity in cell extracts and assess growth on diagnostic substrates

Dominant Negative Approaches

For studying subunit interactions and function:

  • Express mutated versions of MtrC with specific alterations in predicted functional domains

  • Create chimeric proteins with subunits from related methanogens to identify species-specific adaptations

  • Utilize site-directed mutagenesis targeting conserved residues to probe structure-function relationships

What are the implications of recent findings about Mtr for understanding broader methanogenesis pathways in diverse environments?

Recent findings about Mtr in M. acetivorans have significant implications for understanding methanogenesis in diverse environments:

  • Ecological niche definition: The absolute requirement for Mtr in M. acetivorans, without functional bypasses, helps explain the ecological distribution of different methanogens in anaerobic environments. Organisms with different methyltransferase systems may occupy specific niches based on substrate availability and energetic constraints .

  • Evolutionary insights: The distinctive features of Mtr in M. acetivorans compared to related methanogens suggest evolutionary adaptations to specific environmental conditions. For instance, the ability of M. acetivorans to couple acetate metabolism with Fe(III) reduction represents a previously undocumented capability for acetotrophic methanogens that may confer advantages in iron-rich environments .

  • Biogeochemical cycling: The finding that M. acetivorans can engage in Fe(III)-dependent respiratory growth alters our understanding of the connections between carbon and iron cycles in anoxic sediments. This metabolic capability nearly doubles growth and acetate consumption in the presence of ferrihydrite [Fe(OH)3], which is common in the environment .

  • Methane mitigation strategies: Understanding the absolute requirement for Mtr provides potential targets for inhibiting methanogenesis in contexts where methane emissions are problematic (e.g., rice paddies, landfills). Targeted disruption of Mtr function could potentially reduce methane production from these sources .

  • Applied biotechnology: Insights into the regulation and function of the Mtr system could inform biotechnological applications, such as engineered microbial systems for converting waste materials to methane as a biofuel. The understanding that M. acetivorans can couple methanogenesis with metal reduction also suggests possibilities for bioremediation applications in contaminated sediments .

These implications highlight the importance of continued research on Mtr and related methyltransferase systems in methanogens from diverse environments.

What are the critical considerations for purifying functionally active recombinant MtrC?

Purifying functionally active recombinant MtrC presents several challenges that must be addressed through careful methodological design:

  • Maintaining membrane protein stability: As a membrane-integral component of the Mtr complex, MtrC requires appropriate detergent conditions throughout purification. Sequential screening of detergents (starting with DDM, LMNG, or digitonin) is recommended to identify conditions that preserve structural integrity and function.

  • Preserving cofactor associations: The Mtr complex involves corrinoid cofactors that are essential for methyltransferase activity. Purification buffers should include stabilizing agents (e.g., betaine, glycerol) and reducing agents (DTT or β-mercaptoethanol) to prevent cofactor oxidation, alongside periodic supplementation with hydroxocobalamin or methylcobalamin during purification .

  • Reconstitution with interaction partners: Since MtrC functions as part of a multi-subunit complex, co-expression or reconstitution with other Mtr subunits may be necessary for full activity. This can be achieved through either co-expression strategies in heterologous systems or through step-wise reconstitution of individually purified components.

  • Activity preservation: Monitoring methyltransferase activity throughout purification using sensitive assays (e.g., detection of CoM-S-CH3 formation) is essential to identify steps where activity may be compromised and optimize accordingly.

  • Storage considerations: Cryoprotectants (10-20% glycerol) and flash-freezing in liquid nitrogen have been shown to better preserve activity compared to standard freezing protocols. For short-term storage, maintaining purified protein at 4°C with protease inhibitors has been more effective than freeze-thaw cycles.

By addressing these considerations, researchers can significantly improve the functional quality of purified recombinant MtrC for subsequent biochemical and structural studies .

How can researchers effectively detect and quantify Mtr activity in cell extracts and with purified enzyme?

Effective detection and quantification of Mtr activity requires specialized techniques that address the unique characteristics of this methyltransferase:

In Cell Extracts

When working with cell extracts from M. acetivorans, the following methods have proven most reliable:

  • Radioisotope assays: Using 14C-labeled methyl donors (CH3-H4SPT) to track methyl transfer to HS-CoM, followed by product separation via HPLC or TLC. This approach offers excellent sensitivity (detection limits in pmol range) but requires appropriate radioisotope handling facilities.

  • Coupled enzyme assays: Linking methyl-S-CoM formation to NADH oxidation through subsequent enzymatic reactions, allowing spectrophotometric monitoring at 340 nm. This approach provides real-time kinetic data but may be influenced by interfering activities in crude extracts.

  • LC-MS/MS detection: Using multiple reaction monitoring (MRM) to quantify methyl-S-CoM formation with high specificity. Modern instruments achieve detection limits of 0.1-1 nmol, making this suitable for low-activity samples.

With Purified Enzyme

For purified recombinant MtrC and reconstituted complexes:

MethodPrincipleSensitivityAdvantagesLimitations
SpectrophotometricDirect measurement of thiol disappearance (HS-CoM) using DTNB~5-10 nmolSimple, continuous assayPotential interference from reducing agents
HPLC-basedSeparation and detection of HS-CoM and CH3-S-CoM0.5-1 nmolHigh specificityRequires specialized equipment
Coupled ion transportFluorescent detection of Na+ movement in proteoliposomesVariableMeasures energy couplingComplex setup, indirect measurement

For all methods, strict anaerobic conditions are essential as both the enzyme and its cofactors are oxygen-sensitive. Assay buffers should be thoroughly degassed and supplemented with reducing agents (e.g., DTT, 2-mercaptoethanol) to maintain anaerobic conditions throughout measurements .

What experimental design is optimal for investigating potential interactions between Mtr and Mts systems?

An optimal experimental design for investigating potential interactions between Mtr and Mts systems should incorporate multiple complementary approaches:

Genetic Approach

  • Combinatorial mutant analysis: Generate single and double deletion mutants (Δmtr, Δmts, and Δmtr Δmts) to assess phenotypic consequences under various growth conditions. This approach has already provided valuable insights, showing that the phenotype of the double mutant matches that of the single Δmtr mutant, suggesting no functional bypass role for Mts in vivo .

  • Controlled expression systems: Develop strains with inducible expression of Mtr or Mts components to titrate expression levels and examine dosage effects on metabolism and growth.

  • Reporter fusions: Create transcriptional and translational fusions to monitor expression levels and localization patterns of both systems under varying growth conditions.

Biochemical Approach

  • Protein-protein interaction studies: Employ techniques such as co-immunoprecipitation, bacterial two-hybrid systems adapted for archaeal proteins, and proximity labeling methods (BioID, APEX) to identify potential physical interactions between components of the two systems.

  • Activity coupling assays: Design in vitro assays using purified components to examine whether enzymatic activities of one system influence the other, either through direct interactions or via intermediate metabolites.

  • Structural biology: Apply cryo-EM and crosslinking mass spectrometry to characterize potential higher-order assemblies involving components from both systems.

Physiological Approach

  • Metabolic flux analysis: Use 13C-labeled substrates to trace carbon flow through pathways involving Mtr and Mts under different growth conditions.

  • Bioenergetic measurements: Monitor membrane potential, ATP synthesis rates, and ion gradients in wild-type versus mutant strains to assess energetic consequences of system interactions.

  • Real-time monitoring: Develop biosensors for key metabolites to track dynamic changes in response to substrate shifts and genetic perturbations.

This multi-faceted approach would provide comprehensive insights into potential functional interactions between these methyltransferase systems, moving beyond the current understanding that suggests they operate largely independently .

What gaps remain in our understanding of MtrC structure-function relationships?

Despite significant progress in understanding the biological role of the Mtr complex, several critical gaps remain in our knowledge of MtrC structure-function relationships:

Addressing these gaps would significantly enhance our understanding of how this critical component contributes to methanogenesis in M. acetivorans and related organisms .

How might comparative analysis across diverse methanogens inform optimization of recombinant MtrC production?

Comparative analysis across diverse methanogens offers valuable insights for optimizing recombinant MtrC production:

  • Sequence conservation patterns: Alignment of MtrC homologs from diverse methanogens reveals highly conserved residues likely essential for function versus variable regions that may reflect species-specific adaptations. Focusing on conserved core regions while potentially modifying variable regions could enhance heterologous expression without compromising function.

  • Thermal stability adaptations: MtrC proteins from thermophilic methanogens (e.g., Methanothermobacter species) contain adaptations that enhance thermal stability. Incorporating these features—such as increased salt bridge networks, hydrophobic packing, and disulfide bonds—into recombinant constructs could improve stability during purification and storage.

  • Codon optimization strategies: Analysis of codon usage across methanogens can inform species-specific codon optimization strategies for heterologous expression. Comparative analysis reveals that different methanogens have distinct codon preferences, particularly for rare amino acids, which should guide optimization for the chosen expression host.

  • Co-factor binding domains: Comparative structural prediction across methanogen MtrC homologs highlights conserved motifs involved in cofactor binding. Ensuring these domains remain intact and properly folded is critical for producing functionally active recombinant protein.

  • Expression host selection: Different methanogens operate in diverse environmental conditions (pH, salt concentration, temperature). This comparative information can guide selection of expression hosts and culture conditions that better match the native environment of the source organism.

This comparative approach has already proven valuable in related systems. For example, understanding the differences between methyltransferase systems across Methanosarcina species has helped elucidate their specialized roles in different metabolic pathways and environments .

What are the potential applications of engineered MtrC variants in biotechnology and synthetic biology?

Engineered MtrC variants offer several promising applications in biotechnology and synthetic biology:

These applications would require overcoming significant challenges in protein engineering and heterologous expression but offer exciting possibilities for harnessing the unique capabilities of this specialized methyltransferase system .

What are the most significant recent advances in understanding MtrC function and what critical questions remain?

The most significant recent advances in understanding MtrC function have reshaped our understanding of methanogenesis in M. acetivorans. Research has conclusively demonstrated that despite previous hypotheses, there is no functional in vivo bypass of the Mtr system in this organism, establishing Mtr (including the MtrC subunit) as absolutely essential for methanogenesis from various substrates . Additionally, studies have revealed that M. acetivorans can couple acetate metabolism with Fe(III) reduction, a previously undocumented capability for acetotrophic methanogens that involves the Mtr system and expands our understanding of energy conservation mechanisms in these organisms .

Despite these advances, several critical questions remain:

  • What is the atomic-level structure of MtrC and how does it integrate into the complete Mtr complex architecture?

  • What are the precise molecular mechanisms coupling methyl transfer reactions to ion translocation across the membrane?

  • How do post-translational modifications and protein-protein interactions regulate MtrC function under different environmental conditions?

  • What evolutionary adaptations in MtrC account for the metabolic versatility of M. acetivorans compared to other methanogens?

  • How might the unique properties of MtrC be harnessed for biotechnological applications, particularly in bioenergy and bioremediation?

Addressing these questions will require integrating advanced structural biology approaches with genetic, biochemical, and biophysical methods. The continued investigation of this fascinating system promises to yield insights that extend beyond methanogenesis to broader principles of energy conservation in microbial systems and may inspire novel biotechnological applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.