Recombinant Methanosarcina acetivorans Tetrahydromethanopterin S-methyltransferase subunit D (mtrD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on your purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mtrD; MA_0275; Tetrahydromethanopterin S-methyltransferase subunit D; N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Target Names
mtrD
Target Protein Sequence
MIDALMANILWLVFIIIGGVLISWSVHFVPVGGAPAAMAQATGIGTGTVQLAAGAGLTGL VSAGFMMNVTDNLPLILASGAVGAMIMISVTMIVGTWVYVYGVGCVPSSAKVKYDPITKY RQDLYVSQGTEGHGLPTVSFVSGVIGGLLGGIGGALVYYSLIEVGLTAGLSTGTSSGVTG HELVGIAAMFAIGIFFVNAVIPSYNIGGTIEGFHDPKWKKWPKAVISSFVATILCAIVAV IAISQLGGI
Uniprot No.

Target Background

Function
This protein is part of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This is an energy-conserving, sodium-ion translocating step.
Database Links

KEGG: mac:MA_0275

STRING: 188937.MA0275

Protein Families
MtrD family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of mtrD in the methanogenesis pathway of M. acetivorans?

The mtrD subunit is one component of the membrane-bound methyl-H4MPT:coenzyme M methyltransferase (Mtr) complex, which catalyzes a crucial step in the methanogenesis pathway. This enzyme transfers methyl groups from methyl-tetrahydromethanopterin to coenzyme M (CoM), generating methyl-CoM, which is subsequently reduced to methane by methyl-CoM reductase (MCR). The Mtr complex is essential in all methanogenic pathways utilized by M. acetivorans, as these diverse pathways converge at the methyl-CoM stage before final reduction to methane . This functionality makes the Mtr complex, including mtrD, indispensable for energy metabolism in M. acetivorans regardless of which substrate (methanol, methylamines, acetate, etc.) is being utilized.

Why is mtrD considered essential for M. acetivorans survival?

Similar to the mcrBDCGA operon (encoding methyl-CoM reductase) that has been experimentally proven essential through conditional gene inactivation studies , the mtr operon containing mtrD is considered essential because it catalyzes an irreplaceable step in methanogenesis. All methanogenic pathways in M. acetivorans require the transfer of methyl groups to CoM, making the Mtr complex a metabolic bottleneck. Without functional mtrD, the organism would be unable to complete the methanogenic pathway, which is the primary energy-yielding process for this archaeon. This essentiality makes mtrD particularly important for research into methanogen metabolism and potential targets for inhibiting methane production.

How do post-translational modifications affect mtrD activity?

Post-translational modifications (PTMs) significantly impact the function of methanogenic enzymes. While specific PTMs for mtrD have not been extensively characterized, research on other methanogenic enzymes like methyl-CoM reductase (MCR) demonstrates that methylation of arginine residues can substantially impact both methanogenesis and growth even under non-stress conditions . These modifications are highly conserved among methanogens, suggesting critical functional importance.

In the context of mtrD, researchers should investigate whether similar PTMs occur and how they might alter the protein's conformation, stability, or catalytic efficiency. The methylation events likely use S-adenosylmethionine (SAM) as the methyl donor , and identifying the specific methyltransferases responsible for mtrD modifications would represent an important research direction.

What structural features enable mtrD to participate in membrane-associated methyl transfer reactions?

As part of the membrane-bound Mtr complex, mtrD must possess structural features that facilitate its integration into the membrane while maintaining its catalytic function. Understanding these features requires comparative structural analysis with other membrane-bound methyltransferases. Research should focus on identifying transmembrane domains, amphipathic helices, or protein-protein interaction motifs that anchor mtrD in the membrane complex.

The interaction between mtrD and the lipid membrane likely involves specific membrane adaptations characteristic of archaeal cell envelopes. Studies on methanogen cell surfaces affected by medium-chain fatty acids have shown that membrane-associated processes and cell-surface proteins are particularly vulnerable to disruption , suggesting that the membrane environment is crucial for proper mtrD function.

How does mtrD coordinate with electron transfer systems in M. acetivorans?

Methanogenesis requires coordinated electron transfer between various redox proteins. In M. acetivorans, the NADPH-dependent thioredoxin system (composed of MaTrxR and MaTrx7) likely serves as a primary intracellular reducing system . The reduction of disulfide bonds by this system may indirectly affect mtrD function by maintaining the proper redox state of critical cysteine residues.

Additionally, mtrD likely interfaces with methanophenazine, a lipophilic membrane electron carrier involved in reducing CoM-S-S-CoB heterodisulfide via the HdrED enzyme . Understanding how mtrD activity synchronizes with these electron transfer systems is crucial for comprehending the integrated nature of methanogenic metabolism.

What expression systems are most effective for producing functional recombinant mtrD?

Producing functional recombinant mtrD presents significant challenges due to its membrane association and potential requirement for specific archaeal lipid environments. Researchers should consider heterologous expression systems that can accommodate membrane proteins, such as:

  • Modified E. coli strains with archaeal-like lipid compositions

  • Yeast expression systems (Pichia pastoris) for membrane proteins

  • Cell-free expression systems supplemented with archaeal lipids or nanodiscs

Expression should be optimized using controlled induction conditions and fusion tags that facilitate membrane integration. Codon optimization for the expression host is essential, as archaeal codon usage differs significantly from bacterial or eukaryotic systems. Addition of chaperones specific for membrane protein folding may improve yield of functional protein.

What purification strategies maintain mtrD activity?

Purification of membrane-associated methyltransferases requires specialized approaches:

  • Detergent screening is critical - mild detergents like DDM, LMNG, or digitonin often preserve activity

  • Affinity chromatography using engineered tags (His, Strep, FLAG) followed by size exclusion chromatography

  • Inclusion of stabilizing agents like glycerol (10-20%) and reducing agents (DTT or β-mercaptoethanol)

  • Reconstitution into nanodiscs or liposomes containing archaeal lipids to maintain native-like environment

  • All purification steps should be performed at reduced temperatures (4°C) with protease inhibitors present

Activity assays should be performed at each purification step to monitor retention of function, as yield often must be balanced against preservation of catalytic activity.

How can researchers establish reliable assays for mtrD enzymatic activity?

Developing robust assays for mtrD activity requires consideration of its native reaction conditions and substrates:

Assay TypeDetection MethodAdvantagesLimitations
Radioisotope tracking14C-labeled methyl donorsHigh sensitivity, direct measurementRequires specialized facilities, safety concerns
Coupled enzyme assaysSpectrophotometricReal-time monitoringPotential interference from coupling enzymes
Mass spectrometryLC-MS/MS detection of reaction productsHigh specificity, can detect modificationsEquipment-intensive, lower throughput
Fluorescence-basedFluorescent reporter substratesHigh sensitivity, potential for high throughputRequires specialized substrate synthesis

Key considerations include maintaining anaerobic conditions throughout the assay, including appropriate electron donors, and reconstituting the complete methyltransferase complex when necessary for full activity. Controls should include heat-inactivated enzyme and reactions lacking key substrates to establish assay specificity.

How can conditional gene expression systems be used to study mtrD function?

Building on previous work with the mcrBDCGA operon , researchers can develop conditional expression systems for mtrD to study its function:

  • Place a heterologous copy of mtrD under control of a regulated promoter (such as mtaC1 promoter)

  • Integrate this construct into the M. acetivorans chromosome

  • Disrupt the endogenous mtrD gene

  • Use substrate switching (e.g., from methanol to methylamine) to control expression

This approach allows for controlled depletion of mtrD to observe resulting metabolic changes and phenotypes. Time-course experiments during depletion can reveal the immediate effects of reduced mtrD activity before secondary adaptations occur. Transcriptomic and proteomic analyses during these transitions would reveal compensatory responses and regulatory networks connected to mtrD function.

What strategies can be used to investigate mtrD protein-protein interactions?

Understanding mtrD interactions with other Mtr subunits and potential regulatory proteins requires specialized approaches:

  • Bacterial two-hybrid or split-ubiquitin assays adapted for membrane proteins

  • Co-immunoprecipitation using antibodies against mtrD or epitope-tagged versions

  • Crosslinking methods (chemical or photo-crosslinking) to capture transient interactions

  • Proximity labeling approaches (BioID, APEX) to identify proteins in spatial proximity to mtrD

  • Native mass spectrometry of intact Mtr complexes to determine subunit stoichiometry

When designing these experiments, researchers should consider that the membrane environment significantly influences protein-protein interactions. Therefore, detergent selection is critical, and validation in multiple systems is recommended to distinguish genuine interactions from artifacts.

How should researchers design experiments to study mtrD function across different methanogenic pathways?

M. acetivorans can utilize at least four distinct methanogenic pathways depending on available substrates . To understand mtrD's role across these pathways:

  • Culture M. acetivorans on different substrates (methanol, methylamines, acetate, CO)

  • Quantify mtrD expression levels (transcriptomic and proteomic analyses) under each condition

  • Measure methane production rates correlated with mtrD abundance

  • Use metabolic flux analysis with isotope-labeled substrates to track carbon flow through the mtrD-catalyzed reaction

  • Compare kinetic parameters of the methyltransfer reaction with substrates from different methanogenic pathways

This approach would reveal whether mtrD represents a constant or variable component across methanogenic pathways and identify pathway-specific regulatory mechanisms affecting its expression or activity.

How should contradictory results from different mtrD expression systems be reconciled?

Researchers often encounter contradictions when comparing mtrD behavior in different experimental systems:

  • Begin by identifying specific variables between systems (expression host, tags, purification methods)

  • Systematically test the effect of each variable through controlled experiments

  • Validate results in the native M. acetivorans when possible to establish physiological relevance

  • Consider whether apparent contradictions reflect actual regulatory mechanisms (e.g., substrate-dependent effects)

  • Perform structure-function analyses to determine if different constructs preserve key functional domains

What considerations are important when analyzing mtrD expression data across growth conditions?

Analysis of mtrD expression requires careful experimental design and interpretation:

  • Ensure synchronization of cultures when comparing growth phases

  • Account for the effect of terminal electron acceptor availability, as this affects methyltransferase expression

  • Consider how the MsrC regulator responds to intracellular ratios of CoM-S-S-CoB and thiols

  • Distinguish between transcriptional and post-transcriptional regulation

  • Normalize expression data appropriately for accurate comparisons between conditions

Researchers should particularly note that transitions between growth phases can significantly alter expression patterns independent of specific experimental variables being tested. Control experiments that distinguish between specific responses to experimental conditions versus general responses to growth phase transitions are essential.

How can researchers distinguish direct effects of mtrD manipulation from indirect metabolic consequences?

When studying mtrD function through genetic or biochemical manipulation:

  • Include time-course analyses to separate immediate direct effects from secondary adaptations

  • Monitor multiple metabolic pathways simultaneously to identify compensatory responses

  • Use complementation experiments to confirm phenotypes are specifically due to mtrD alterations

  • Employ systems biology approaches (metabolomics, transcriptomics) to map the cascade of effects following mtrD perturbation

  • Develop computational models that predict direct versus indirect effects based on known metabolic network architecture

Particularly informative are experiments that manipulate mtrD activity while providing metabolic bypasses or supplementation with potential limiting intermediates. This approach can distinguish between effects caused by the absence of mtrD's catalytic function versus downstream metabolic disruptions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.