Recombinant Methanosarcina acetivorans UPF0059 membrane protein MA_3749 (MA_3749)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; MA_3749; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Target Names
mntP
Target Protein Sequence
MSFLTNFLLGLGLAMDAFAVSMSSGTTIRPFRVSDALKLAVFFGSFQAMMPVLGWIGGST VSSFVSDYAPWIAFLLLAFIGCKMIYEALYGDQDGKVNSLNYSVLFLLAVATSIDALAVG MSFAFLGTPILEPVIIIGCVTFVMSFCGAILGYRLGHFFEHEVEILGGLILIGLGGKILA EHMLWI
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links

KEGG: mac:MA_3749

STRING: 188937.MA3749

Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanosarcina acetivorans UPF0059 membrane protein MA_3749?

UPF0059 membrane protein MA_3749 is a transmembrane protein found in the archaeon Methanosarcina acetivorans strain ATCC 35395/DSM 2834/JCM 12185/C2A. The protein consists of 186 amino acids spanning the full-length protein and is classified in the UPF0059 protein family . The protein is also referenced in some databases with the locus name MA_RS19535, and its UniProt accession number is Q8TJN1 .

How is the recombinant MA_3749 protein typically stored?

The recombinant protein is typically stored in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein. For short-term storage, it should be kept at -20°C, while for extended storage, temperatures of -20°C or -80°C are recommended. Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing cycles should be avoided as they may compromise protein integrity .

What expression systems are effective for producing MA_3749?

While specific expression system information for MA_3749 is limited in the search results, membrane proteins like MA_3749 can be effectively expressed using engineered systems such as the E. coli-based membrane protein overexpression system utilizing bacterial outer membrane protein F (pOmpF) fusion. This approach has been successful for other membrane proteins with similar characteristics . Cell-free expression systems have also been used for the production of this transmembrane protein .

How does the pOmpF fusion system improve membrane protein expression?

The pOmpF fusion system addresses challenges typically associated with membrane protein expression:

  • It enhances protein yield compared to other common fusion proteins

  • It enables expression in both minimal media (suitable for metabolic labeling and structure determination) and rich media (for higher yields needed in biophysical analysis)

  • It has demonstrated effectiveness for both single-pass and multi-pass transmembrane proteins

  • It produces proteins at scales appropriate for detailed biophysical studies

What purification methods are recommended for MA_3749?

Based on approaches used for similar membrane proteins, purification would likely involve:

  • Initial solubilization using appropriate detergents (similar membrane proteins have been solubilized with FC15)

  • Affinity chromatography leveraging fusion tags (the specific tag type is determined during the production process)

  • Size exclusion chromatography for further purification

  • Quality control using circular dichroism and fluorescence spectroscopy to confirm proper folding and structural integrity

How should experiments involving MA_3749 be designed?

When designing experiments with MA_3749, researchers should follow these systematic steps:

  • Define clear variables - Identify independent variables (e.g., expression conditions, buffer compositions) and dependent variables (e.g., protein yield, activity)

  • Formulate specific, testable hypotheses about MA_3749 function or structure

  • Design experimental treatments that manipulate the independent variables

  • Establish appropriate control groups

  • Develop precise methods to measure dependent variables

  • Control for extraneous variables that might influence results

What spectroscopic methods are suitable for structural analysis of MA_3749?

For structural characterization of membrane proteins like MA_3749, circular dichroism (CD) and fluorescence spectroscopy are valuable techniques. CD spectroscopy can determine secondary structure composition (α-helix, β-sheet content), while fluorescence spectroscopy can provide insights into tertiary structure and conformational changes. These methods have been successfully applied to similar membrane proteins, enabling researchers to assess structural integrity under various conditions and monitor changes upon ligand binding or environmental modifications .

How can researchers assess the stability of purified MA_3749?

Stability assessment of purified MA_3749 should include:

  • Temperature stability tests analyzing structural retention across a range of temperatures (20–60°C)

  • Buffer optimization experiments testing various pH conditions and ionic strengths

  • Detergent compatibility studies to identify conditions that maintain protein folding

  • Long-term storage stability evaluations at different temperatures (-20°C, -80°C)

  • Freeze-thaw cycle analysis to determine tolerance to repeated freezing

What is known about the physiological function of MA_3749 in Methanosarcina acetivorans?

While the specific function of MA_3749 is not explicitly detailed in the search results, contextual information about M. acetivorans metabolism provides some insights. M. acetivorans possesses gluconeogenic and glycolytic capabilities but cannot naturally utilize glucose for methanogenesis and growth. The UPF0059 membrane protein may play a role in the organism's unique metabolic pathways, possibly related to substrate transport or membrane integrity in these specialized archaeal cells .

How might MA_3749 be involved in the metabolic capabilities of M. acetivorans?

As a membrane protein in M. acetivorans, MA_3749 could potentially be involved in:

  • Transport mechanisms for substrates used in methanogenesis

  • Membrane adaptations necessary for survival in M. acetivorans' natural environment

  • Signaling pathways related to metabolic regulation

  • Structural components supporting membrane integrity during metabolic shifts

Research indicates that M. acetivorans has specific metabolic limitations, such as the inability to utilize glucose effectively despite having glycolytic pathways. When recombinant strains were created to facilitate glucose uptake, they exhibited glucose-dependent growth inhibition associated with intracellular carbohydrate accumulation. The membrane proteome, including proteins like MA_3749, may be involved in these complex metabolic regulations .

How can researchers investigate potential protein-protein interactions involving MA_3749?

To investigate protein-protein interactions, researchers should consider:

  • Co-immunoprecipitation experiments using antibodies against MA_3749 or potential interaction partners

  • Yeast two-hybrid or bacterial two-hybrid screening systems adapted for membrane proteins

  • Bimolecular fluorescence complementation assays in appropriate host cells

  • Surface plasmon resonance to measure binding kinetics between purified MA_3749 and candidate partners

  • Cross-linking mass spectrometry to identify protein complexes in native membranes

These approaches should be optimized for membrane proteins, potentially using specialized detergents to maintain protein structure during interaction analysis.

What approaches can address the challenges of crystallizing membrane proteins like MA_3749?

Membrane protein crystallization presents significant challenges. Researchers should consider:

  • Detergent screening to identify optimal solubilization conditions

  • Lipidic cubic phase crystallization, which better mimics the membrane environment

  • Protein engineering to improve crystallization properties:

    • Removal of flexible regions

    • Introduction of stabilizing mutations

    • Fusion with crystallization chaperones

  • Crystallization in nanodiscs or amphipols to maintain native-like environments

  • Complementary structural methods such as cryo-electron microscopy if crystallization proves difficult

How can researchers reconcile contradictory data regarding glucose metabolism in M. acetivorans strains?

When addressing contradictions in the literature, such as reported differences in glucose utilization by M. acetivorans strains:

  • Perform comparative analysis of the specific strains used in different studies, noting genetic differences

  • Examine experimental conditions in detail, as growth media components can significantly affect metabolic outcomes

  • Consider time-course experiments to detect transient metabolic adaptations

  • Analyze the expression levels of key proteins (potentially including MA_3749) under different conditions

  • Develop strain-specific metabolic models incorporating membrane transport functions

Research has noted contradictions in glucose utilization data, specifically regarding "reportedly unimpaired growth of a M. acetivorans strain containing glk" versus observations of glucose-dependent growth inhibition . Resolving such contradictions requires careful experimental design and thorough metabolic characterization.

What strategies can improve low yields in membrane protein expression?

To address low expression yields:

  • Optimize codon usage for the expression host

  • Test different fusion partners (pOmpF has shown promise for other membrane proteins)

  • Evaluate various expression temperatures and induction conditions

  • Consider specialized expression hosts designed for membrane proteins

  • Explore cell-free expression systems that bypass cellular toxicity issues

  • Implement high-throughput screening of expression conditions

How can researchers minimize protein aggregation during purification?

To reduce aggregation during purification:

  • Screen multiple detergents for optimal solubilization

  • Include appropriate stabilizing agents in buffers (glycerol, specific salts)

  • Maintain samples at 4°C throughout purification

  • Consider adding lipids that might stabilize the native conformation

  • Optimize protein concentration to prevent aggregation at high concentrations

  • Use size exclusion chromatography as a final polishing step to remove aggregates

What control experiments should be included when studying MA_3749 function?

Essential control experiments include:

  • Expression and purification of a non-functional mutant version of MA_3749

  • Parallel analysis of empty vector controls in expression studies

  • Heat-denatured protein controls for activity assays

  • Comparative analysis with related UPF0059 family proteins from other species

  • Detergent-only controls to distinguish detergent effects from protein-specific effects

  • Expression time-course studies to identify optimal harvest points

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.