Recombinant Methanosarcina acetivorans UPF0060 membrane protein MA_3936 (MA_3936)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Full Length Methanosarcina acetivorans UPF0060 membrane protein MA_3936(MA_3936) Protein is a protein that consists of 155 amino acids (1-155aa) . It is fused to an N-terminal His tag and expressed in E. coli . The protein is available as a lyophilized powder .

Cat.No. :RFL35830MF
Product Overview :Recombinant Full Length Methanosarcina acetivorans UPF0060 membrane protein MA_3936(MA_3936) Protein (Q8TJ52) (1-155aa), fused to N-terminal His tag, was expressed in E. coli .
Species :Methanosarcina acetivorans
Source :E. coli
Tag :His
Protein Length :Full Length (1-155)
Form :Lyophilized powder
AA Sequence :MIELGVSLCPFFLAALFEIRGGYLICLWLRNNMRAVFGPLGRLMLAVCGIIPTFQPSHFG
RVYAAHGGIFIVFSLIWDLFVDKKIPDRYDHRGNNNVCGCFHYVLRLSLIGRYSVISFCN
FQTPRQRISDFFLSRSIKHNFYLFFCNQTLGNYFV
Purity :Greater than 90% as determined by SDS-PAGE .
Notes :Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week .
Storage :Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage Buffer :Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution :Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .
Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Default final concentration of glycerol is 50%. Customers could use it as a reference .
Gene NameMA_3936
SynonymsMA_3936; UPF0060 membrane protein MA_3936
UniProt IDQ8TJ52

Function and Role in Methanosarcina acetivorans

MA_3936 is annotated as a UPF0060 (Unknown Protein Function) membrane protein . M. acetivorans uses an electron transport chain (ETC) to conserve energy . The Rnf (Rhodobacter nitrogen fixation) complex donates electrons to the ETC via ferredoxin . MmcA is a multiheme c-type cytochrome (MHC) subunit contained in the Rnf complex of M. acetivorans . MmcA may have a cellular function beyond facilitating electron flow through the Rnf complex .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Proteins are shipped with blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MA_3936; UPF0060 membrane protein MA_3936
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Target Names
MA_3936
Target Protein Sequence
MIELGVSLCPFFLAALFEIRGGYLICLWLRNNMRAVFGPLGRLMLAVCGIIPTFQPSHFG RVYAAHGGIFIVFSLIWDLFVDKKIPDRYDHRGNNNVCGCFHYVLRLSLIGRYSVISFCN FQTPRQRISDFFLSRSIKHNFYLFFCNQTLGNYFV
Uniprot No.

Target Background

Database Links

KEGG: mac:MA_3936

Protein Families
UPF0060 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanosarcina acetivorans UPF0060 membrane protein MA_3936?

Methanosarcina acetivorans UPF0060 membrane protein MA_3936 is a 155-amino acid membrane protein from the methanogenic archaeon Methanosarcina acetivorans. It belongs to the UPF0060 protein family (Uncharacterized Protein Family 0060) and has the UniProt identifier Q8TJ52 . The protein is part of the genomic complement of M. acetivorans, which possesses one of the largest known methanoarchaeal genomes and has become an important model organism for studying methanogenesis and archaeal membrane biology .

The protein's classification as UPF0060 indicates that while its sequence and structure have been determined, its specific biological function remains uncharacterized. This represents a significant research opportunity for membrane protein biochemists and archaeal biologists seeking to elucidate novel protein functions in methanogens.

How is recombinant MA_3936 typically produced for research purposes?

Recombinant MA_3936 can be produced using several expression systems, with E. coli being the most commonly utilized host due to its high yield and relatively short production time . The standard production protocol involves:

  • Cloning the MA_3936 gene into an expression vector (typically pET28a) with an N-terminal His-tag

  • Transformation into an E. coli expression strain

  • Induction of protein expression

  • Cell lysis under conditions that maintain membrane protein integrity

  • Purification using affinity chromatography (His-tag)

  • Buffer exchange to stabilize the purified protein

The recombinant protein is typically stored in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 to maintain stability . When higher levels of post-translational modifications are required, expression in eukaryotic systems such as yeast, insect cells with baculovirus, or mammalian cells can be employed, although these typically result in lower yields .

Expression SystemAdvantagesDisadvantagesRecommended Application
E. coliHigh yield, fast turnaround, cost-effectiveLimited post-translational modificationsBasic biochemical and structural studies
YeastModerate yield, some post-translational modificationsLonger production time than E. coliStudies requiring moderate eukaryotic modifications
Insect cellsGood post-translational modificationsLower yield, longer production timeFunctional studies requiring proper folding
Mammalian cellsExtensive post-translational modificationsLowest yield, longest production time, highest costStudies of complex protein interactions or function

How might MA_3936 function within the metabolic network of M. acetivorans?

While the specific function of MA_3936 remains uncharacterized, its context within M. acetivorans metabolism suggests several possible roles. M. acetivorans is a versatile methanogen capable of utilizing methylated compounds, carbon monoxide, or acetate as energy sources, producing methane as a byproduct . As a membrane protein, MA_3936 could potentially be involved in:

  • Redox processes: M. acetivorans contains a complex electron transport system featuring heterodisulfide reductase (Hdr) enzymes. Given the presence of cysteine residues in MA_3936, it might participate in redox reactions similar to those involving the thioredoxin system in M. acetivorans .

  • Substrate transport: The protein could function in the transport of specific substrates across the membrane, possibly related to methanogenesis pathways.

  • Signal transduction: M. acetivorans possesses an extensive signaling network with 53 putative histidine kinases and 16 putative response regulators . MA_3936 might function within a membrane-associated signaling complex.

The absence of the Fpo complex and Rnf complex in some Methanosarcinales species suggests metabolic specialization , and MA_3936 could potentially be part of an alternative electron transport or energy conservation system specific to M. acetivorans.

What experimental approaches can elucidate the function of MA_3936?

Several complementary approaches can be employed to determine the function of this uncharacterized membrane protein:

  • Genetic approaches:

    • Gene deletion studies assessing phenotypic changes in growth rate, substrate utilization, or stress response

    • Complementation studies in mutant strains

    • Expression profiling under different growth conditions

  • Biochemical approaches:

    • Protein-protein interaction studies using pull-down assays or co-immunoprecipitation

    • Substrate binding assays with potential metabolites

    • Enzymatic activity assays testing various potential functions

  • Structural biology approaches:

    • Crystallography or cryo-EM to determine three-dimensional structure

    • Site-directed mutagenesis of conserved residues followed by functional assays

  • Systems biology approaches:

    • Integration with genome-scale metabolic models like iST807 used for M. acetivorans

    • Flux balance analysis to predict metabolic impacts

    • Comparative genomics with related methanogenic archaea

Parsimonious flux balance analysis (pFBA) can be particularly valuable, as demonstrated for other M. acetivorans proteins, using equations like:

minjJvj\min \sum_{j \in J} |v_j|

s.t. Sv=0\text{s.t. } S \cdot v = 0

vbiomass=vbiomassmaxv_{biomass} = v_{biomass}^{max}

Where S is the stoichiometric matrix, v represents flux values, and the objective is to identify the most efficient enzyme usage pattern to achieve maximum biomass production .

How can researchers overcome challenges in studying membrane proteins like MA_3936?

Studying archaeal membrane proteins presents several unique challenges:

  • Solubility and stability issues:

    • Use specialized detergents optimized for archaeal membrane proteins

    • Consider nanodiscs or amphipols for maintaining native-like membrane environments

    • Employ buffer optimization screens with varying pH, salt concentrations, and stabilizing agents

  • Expression challenges:

    • Test multiple expression systems (E. coli strains, archaeal hosts)

    • Optimize codon usage for the expression host

    • Consider fusion partners that enhance solubility

  • Functional characterization difficulties:

    • Develop specialized assays that account for archaeal physiological conditions

    • Use anaerobic techniques when necessary, as M. acetivorans is an obligate anaerobe

    • Implement in vivo approaches like localization studies with FLAG-tagged proteins, similar to methods used for MaTrx3 and MaTrx6 proteins in M. acetivorans

  • Structural analysis complications:

    • Consider lipid cubic phase crystallization for membrane proteins

    • Employ cryo-EM for larger membrane protein complexes

    • Use molecular dynamics simulations to predict behavior in archaeal membranes

Maintaining anaerobic conditions is particularly important when working with proteins from methanogens like M. acetivorans, as exposure to oxygen can compromise protein structure and function .

What is the optimal protocol for purifying recombinant MA_3936 while maintaining its native conformation?

Purification of MA_3936 with preserved native conformation requires careful attention to membrane protein handling techniques:

  • Cell lysis and membrane fraction isolation:

    • Use gentle lysis techniques (e.g., French press or sonication with cooling)

    • Separate membrane fraction via ultracentrifugation (typically 100,000 × g)

    • Perform all steps under anaerobic conditions when possible

  • Solubilization:

    • Screen detergents (n-dodecyl-β-D-maltoside, digitonin, CHAPS) for optimal solubilization

    • Maintain pH between 7.5-8.0 based on MA_3936's storage buffer requirements

    • Include protease inhibitors (e.g., 1 mM benzamidine, 1 mM PMSF) as used in M. acetivorans protein studies

  • Affinity purification:

    • Use Ni-NTA chromatography for His-tagged MA_3936

    • Apply imidazole gradient elution to minimize contaminants

    • Include stabilizing agents (e.g., 6% Trehalose) in all buffers

  • Secondary purification:

    • Size exclusion chromatography to separate aggregates and ensure homogeneity

    • Ion exchange chromatography if additional purity is required

  • Quality control:

    • SDS-PAGE with Coomassie staining (>90% purity expected)

    • Western blotting with anti-His antibodies

    • Circular dichroism to verify secondary structure integrity

The purified protein can be reconstituted into liposomes or nanodiscs for functional studies, maintaining an environment similar to the archaeal membrane.

How can researchers design experiments to investigate protein-protein interactions involving MA_3936?

Investigating potential protein-protein interactions of MA_3936 requires specialized approaches for membrane proteins:

  • Crosslinking studies:

    • Chemical crosslinking with membrane-permeable crosslinkers (DSP, DTSSP)

    • UV-activated crosslinking for capturing transient interactions

    • Mass spectrometry analysis of crosslinked complexes

  • Co-immunoprecipitation approaches:

    • Express FLAG-tagged MA_3936 in M. acetivorans as done for MaTrx3 and MaTrx6

    • Isolate membrane fractions under native conditions

    • Perform immunoprecipitation with anti-FLAG antibodies

    • Identify interacting partners by mass spectrometry

  • Bacterial/archaeal two-hybrid systems:

    • Adapt split-ubiquitin system for membrane protein interactions

    • Use bacterial two-hybrid systems optimized for membrane proteins

  • Proximity labeling approaches:

    • BioID or APEX2 fusion proteins to identify neighboring proteins in the membrane

    • Expression in native M. acetivorans or suitable host

  • Microscopy techniques:

    • Fluorescence resonance energy transfer (FRET) to detect interactions in situ

    • Super-resolution microscopy for co-localization studies

These approaches should be complemented with bioinformatic analyses to predict potential interaction partners based on genomic context, co-expression data, and presence in related operons in M. acetivorans.

What strategies can optimize the stability and activity of MA_3936 during experimental procedures?

Maintaining MA_3936 stability throughout experimental procedures requires specialized approaches:

  • Buffer optimization:

    • Use Tris/PBS-based buffer with 6% Trehalose at pH 8.0 as a starting point

    • Screen additives that stabilize membrane proteins (glycerol, specific lipids)

    • Include reducing agents if cysteine residues are critical (considering M. acetivorans' thioredoxin system)

  • Storage conditions:

    • Store at -20°C/-80°C in aliquots to avoid freeze-thaw cycles

    • Consider flash-freezing in liquid nitrogen

    • Add cryoprotectants like glycerol (10-20%) or Trehalose (6%)

  • Handling protocols:

    • Maintain anaerobic conditions when possible, especially for functional studies

    • Use oxygen-scavenging systems if anaerobic chambers are unavailable

    • Work at 4°C to minimize protein degradation

  • Reconstitution approaches:

    • Test different lipid compositions for reconstitution

    • Consider archaeal-specific lipids for more native-like environment

    • Use controlled detergent removal methods (dialysis, Bio-Beads)

  • Activity preservation:

    • Identify essential cofactors that might be required for activity

    • Consider the redox environment based on M. acetivorans metabolism

    • Test activity under conditions mimicking methanoarchaeal cytoplasm

Functional assays should account for the possible involvement of MA_3936 in electron transfer chains, given the importance of such processes in M. acetivorans metabolism .

How does MA_3936 compare to similar proteins in other methanogenic archaea?

Comparative analysis of MA_3936 with similar proteins in other methanogens provides insights into its potential evolutionary significance and function:

  • Sequence homology:

    • MA_3936 belongs to the UPF0060 family, which has representatives across multiple archaeal species

    • Sequence alignment reveals conserved transmembrane domains and potential functional residues

    • Conservation patterns can highlight functionally important regions

  • Genomic context:

    • In M. acetivorans, the genomic neighborhood of MA_3936 may provide clues about its function

    • Comparison with gene arrangements in other methanogens can reveal conserved operons

    • Analysis of horizontal gene transfer patterns may indicate acquisition of novel functions

  • Structural comparison:

    • Homology modeling based on related proteins with known structures

    • Comparison of predicted transmembrane topologies across methanogenic species

    • Analysis of conserved potential binding sites or catalytic residues

  • Phylogenetic distribution:

    • Presence in specific methanogenic lineages may correlate with metabolic capabilities

    • Correlation with specific methanogenesis pathways (e.g., methylotrophic, acetoclastic)

    • Analysis of co-evolution with other proteins or metabolic pathways

M. acetivorans possesses unique metabolic capabilities compared to other methanogens, including the ability to grow on multiple substrates , which may inform the specialized function of MA_3936 in this organism.

What insights can genome-scale metabolic models provide about the potential function of MA_3936?

Genome-scale metabolic models (GEMs) like iST807 for M. acetivorans can provide systems-level insights into MA_3936 function:

  • Model-based predictions:

    • In silico gene knockout simulations to predict phenotypic effects

    • Flux distribution analysis under different growth conditions

    • Identification of potential metabolic bottlenecks affected by the protein

  • Integration with experimental data:

    • Correlation of transcriptomics data with metabolic flux predictions

    • Refinement of models based on phenotypic observations

    • Validation of predictions using targeted experiments

  • Comparative metabolic analysis:

    • Analysis of differences in metabolic pathways between M. acetivorans and related methanogens

    • Identification of unique metabolic capabilities that may involve MA_3936

    • Examination of potential roles in energy conservation systems

The parsimonious flux balance analysis (pFBA) approach used in M. acetivorans studies employs a stoichiometric matrix (S) with metabolites and reactions, and flux values (v) for each reaction, solving an optimization problem to achieve maximum biomass growth rate while minimizing the sum of absolute flux values .

How can researchers design experiments to investigate the role of MA_3936 in different metabolic conditions?

Investigating MA_3936's role across metabolic conditions requires systematic experimental design:

  • Growth condition variations:

    • Compare expression and localization of MA_3936 across different growth substrates (methanol, acetate, carbon monoxide)

    • Analyze effects of electron acceptor availability

    • Examine responses to stress conditions (sulfide limitation, temperature, pH)

  • Gene manipulation strategies:

    • Generate knockout or knockdown mutants of MA_3936

    • Create conditional expression systems

    • Introduce site-specific mutations in conserved residues

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Correlate MA_3936 expression with metabolic shifts

    • Identify potential regulatory networks involving MA_3936

  • Specific functional hypotheses testing:

    • If suspected to be involved in electron transport, measure redox activities

    • For potential transport functions, conduct substrate uptake assays

    • For signaling roles, analyze phosphorylation states and response regulation

  • Comparative physiological studies:

    • Compare wild-type and MA_3936 mutant strains under different growth conditions

    • Measure growth rates, substrate utilization, and methane production

    • Analyze changes in metabolic efficiency similar to studies on HdrABC in M. acetivorans

These approaches should consider the complex metabolic adaptations observed in M. acetivorans, such as the respiratory adaptation to different substrates and the role of electron bifurcation in energy conservation .

What emerging technologies could advance our understanding of MA_3936 function?

Several cutting-edge technologies hold promise for elucidating MA_3936 function:

  • Cryo-electron microscopy advances:

    • Single-particle analysis for structural determination without crystallization

    • Tomography for visualizing MA_3936 in its native membrane environment

    • In situ structural studies within archaeal cells

  • Advanced genetic tools:

    • CRISPR-Cas9 systems adapted for archaeal genome editing

    • Inducible gene expression systems for M. acetivorans

    • High-throughput mutagenesis approaches for functional mapping

  • Single-molecule techniques:

    • FRET-based conformational change analysis

    • Patch-clamp techniques if transport functions are suspected

    • Force spectroscopy for membrane protein dynamics

  • Computational approaches:

    • Molecular dynamics simulations in archaeal membrane environments

    • Machine learning for function prediction from sequence/structure

    • Integration of multi-omics data with network models

  • Synthetic biology strategies:

    • Reconstitution of minimal systems with defined components

    • Creation of chimeric proteins to test domain functions

    • Development of biosensors based on MA_3936 for specific metabolites

These technologies could help overcome the significant challenges in studying archaeal membrane proteins and provide unprecedented insights into their functions in the unique biochemistry of methanogens.

How might understanding MA_3936 contribute to broader knowledge of archaeal membrane biology?

Elucidating MA_3936 function would advance several areas of archaeal biology:

  • Evolutionary insights:

    • Understanding the adaptation of membrane proteins in extremophilic environments

    • Tracing the evolution of energy conservation mechanisms in archaea

    • Identifying potential ancient protein functions predating the archaeal-bacterial divergence

  • Archaeal membrane bioenergetics:

    • Clarifying unique aspects of ion or electron transport across archaeal membranes

    • Uncovering novel energy conservation mechanisms

    • Understanding the integration of membrane proteins in methanogenesis pathways

  • Signaling systems in archaea:

    • Potential roles in the complex signaling network of M. acetivorans

    • Understanding how membrane proteins participate in environmental sensing

    • Identification of unique archaeal signal transduction mechanisms

  • Biotechnological applications:

    • Development of archaeal cell factories for biotechnology

    • Engineering methanogens for enhanced biofuel production

    • Design of protein scaffolds stable in extreme conditions

The characterization of MA_3936 would contribute to addressing the significant knowledge gap in archaeal signal transduction and membrane protein function, as highlighted by the limited experimental investigations in this field despite increasing genomic data .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.