Recombinant Methanosarcina barkeri CoB--CoM heterodisulfide reductase subunit E (hdrE)

Shipped with Ice Packs
In Stock

Description

Functional Role in Methanogenesis

HdrE is integral to the HdrED complex, which catalyzes the reduction of CoB–S–S–CoM (heterodisulfide) to regenerate CoB-SH and CoM-SH, critical for methane synthesis . The complex operates as a terminal oxidoreductase, accepting electrons from reduced methanophenazine (MPH₂) and translocating protons across the membrane to generate a proton gradient for ATP synthesis .

Table 2: Functional Attributes of HdrED

AttributeDescription
Electron DonorReduced methanophenazine (MPH₂)
Proton TranslocationCoupled to heterodisulfide reduction
Energy ConservationDrives ATP synthesis via proton gradient
Substrate SpecificityCoB–S–S–CoM (heterodisulfide)

Recombinant Production and Applications

Recombinant HdrE is purified via affinity chromatography using its His tag . Its production in E. coli facilitates biochemical and structural studies, though challenges may arise due to its membrane-bound nature and cytochrome components. HdrE is used to study:

  • Electron transfer mechanisms between methanophenazine and HdrED .

  • Proton translocation dynamics in methanogenesis .

  • Regulatory interactions with other methanogenic enzymes .

Regulatory Context

HdrED (including HdrE) is constitutively expressed and essential for viability under all growth conditions in Methanosarcina species . In contrast, the cytoplasmic HdrABC complex (encoded by hdrBCA) is regulated by HdrR, a transcriptional activator, and is substrate-specific (e.g., methylotrophic growth) .

Table 3: Regulatory Comparison of Hdr Complexes

ComplexRegulationSubstrate Specificity
HdrEDConstitutive expression Acetate, H₂/CO₂, methanol
HdrABCHdrR-dependent Methylotrophic substrates

Research Implications

  1. Methanogenesis Efficiency: HdrED’s proton translocation is pivotal for ATP synthesis, making it a target for understanding energy conservation in methanogens .

  2. Climate Impact: Inhibiting HdrED could reduce methane emissions, a key strategy for mitigating climate change .

  3. Evolutionary Insights: The coexistence of HdrED and HdrABC in Methanosarcinales highlights adaptive metabolic flexibility .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly packaged with regular blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
hdrE; Mbar_A1598; Dihydromethanophenazine:CoB--CoM heterodisulfide reductase subunit E; CoB--CoM heterodisulfide reductase subunit E; Coenzyme B:coenzyme M:methanophenazine oxidoreductase subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-263
Protein Length
full length protein
Species
Methanosarcina barkeri (strain Fusaro / DSM 804)
Target Names
hdrE
Target Protein Sequence
MSEEMLYFSGLSDVLRMTFVQIMIFSTIAIVIFLYGLISNFQKWGTGVTGYALEPQEGKK GSAITFLKTWWSQVTAESHHRGESILEILILDILFQRRILKRSPFRWVMHLFIFGGWMTL FALSGMMFAVEMTEKIGIALPFTPAEFRDFLSIPNYIFGYILLIGVLVALVRRLFVSEVR EASIMYDWVLIGIVFLVTISGFIADGIRTGFIWSFGLDPSVAPPAALFHSIFSLLFCIAF IPYSKYIHIIAIPLALLANKGGE
Uniprot No.

Target Background

Function
This protein is part of a complex that catalyzes the reversible reduction of CoM-S-S-CoB to the thiol-coenzymes H-S-CoM (coenzyme M) and H-S-CoB (coenzyme B). HdrE likely functions in anchoring the complex to the membrane.
Database Links
Protein Families
HdrE family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of HdrE in the metabolism of Methanosarcina barkeri?

HdrE is a critical subunit of the membrane-bound heterodisulfide reductase complex (HdrED) in M. barkeri. This enzyme functions as the terminal oxidoreductase in the electron transport chain, catalyzing the reduction of the CoM-S-S-CoB heterodisulfide to regenerate the thiol forms of coenzyme M (CoM-SH) and coenzyme B (CoB-SH), which are essential for subsequent rounds of methanogenesis .

The HdrED complex uses reduced methanophenazine as an electron donor, and upon oxidation of the reduced methanophenazine, protons are translocated across the cell membrane. This process creates a proton gradient that is harnessed by ATP synthase for ATP production, thereby conserving energy in the cell . This makes HdrE essential for energy conservation in methanogenic archaea growing on certain substrates.

How does HdrE differ from other heterodisulfide reductase subunits in methanogens?

HdrE is specifically part of the membrane-bound HdrED complex found in Methanosarcina species, which differs from the cytoplasmic heterodisulfide reductase HdrABC found in some methanogens. Unlike the non-energy-conserving cytoplasmic HdrABC, the membrane-bound HdrED plays a direct role in energy conservation through proton translocation and establishment of a membrane potential .

The functional differences between these enzyme complexes are reflected in their metabolic consequences. For instance, deletion of the non-energy-conserving HdrABC results in higher metabolic efficiency but slower growth, while depletion of HdrED causes severe energy stress and metabolic imbalance, highlighting its essential role in energy conservation .

What experimental approaches are commonly used to express recombinant HdrE?

For recombinant expression of M. barkeri HdrE, researchers typically employ several approaches:

  • Heterologous expression in E. coli: Using specialized expression vectors with archaeal codon optimization and tags for purification

  • Homologous expression in Methanosarcina species: Using tools like the tetracycline-responsive TetR repressor system

  • Complementation methods: As demonstrated in studies with Ech hydrogenase, complementation can be achieved by inserting the target genes into permissive sites in the chromosome, such as the hpt locus

When expressing HdrE, it's critical to consider:

  • The need for anaerobic conditions throughout the purification process

  • Co-expression with HdrD may be necessary for proper folding and activity

  • The requirement for specific cofactors and metal centers during protein reconstitution

How can researchers effectively create conditional knockdowns of HdrE to study its physiological roles?

Creating conditional knockdowns of HdrE requires sophisticated genetic manipulation techniques given the essential nature of this protein in most growth conditions. Based on published methodologies, an effective approach involves:

  • Tetracycline-responsive repression system: Implementing a TetR repressor and tet operator system to control hdrE transcription. In the absence of tetracycline, TetR binds to the operator sequences, repressing transcription; addition of tetracycline induces expression by preventing TetR binding .

  • Dual promoter strategy: Replace the native hdrE promoter with a controllable promoter while maintaining a second copy under native regulation to prevent lethal effects during genetic manipulation.

  • Time-course depletion studies: After establishing the conditional system, gradually deplete HdrE by removing inducer and monitor physiological parameters at various timepoints. This approach was effectively used in studies of related systems where HdrED depletion resulted in specific transcriptional changes, including upregulation of methyltransferases and coenzyme B biosynthesis genes .

The analysis of growth rates, metabolite profiles, and transcript abundance during HdrE depletion provides valuable insights into its physiological roles. When designing these experiments, it's crucial to establish baseline measurements and include appropriate controls to distinguish between specific HdrE-depletion effects and general growth phase transitions.

What molecular techniques can be used to investigate the interaction between HdrE and other components of the methanogenesis pathway?

Several sophisticated molecular techniques can elucidate the interactions between HdrE and other components of the methanogenesis pathway:

  • Proximity-dependent protein labeling: Using techniques like BioID or APEX2 fused to HdrE to identify proteins in close proximity in vivo under various growth conditions.

  • Co-immunoprecipitation coupled with mass spectrometry: Using antibodies against tagged versions of HdrE to pull down interaction partners, followed by mass spectrometric identification.

  • Membrane cross-linking studies: Employing chemical cross-linkers to capture transient protein-protein interactions within the membrane environment.

  • Genetic suppressor screens: Identifying suppressors of conditional hdrE mutant phenotypes can reveal functional interactions.

  • Chimeric protein construction: Creating fusion proteins between HdrE and putative interaction partners to test functional complementation.

The data from these approaches should be integrated with metabolic flux analysis and in vitro biochemical assays to build a comprehensive model of HdrE interactions within the methanogenesis pathway.

What are the implications of HdrE depletion on transcriptional regulation in Methanosarcina species?

Depletion of HdrED results in significant transcriptional changes that reveal regulatory mechanisms in Methanosarcina species. Based on experimental data, HdrE depletion leads to:

  • Upregulation of methyltransferase genes: Including mtaC2, mtaB3, and mtaC3, suggesting compensatory mechanisms for methyl group transfer in the methanogenesis pathway .

  • Increased expression of coenzyme B biosynthesis genes: Indicating a cellular response to maintain adequate levels of this essential cofactor .

  • Altered expression of C1 metabolism and pyrimidine compound genes: Reflecting broader metabolic adjustments to energy limitation .

These transcriptional changes are distinct from those observed during the transition from exponential to stationary phase growth, suggesting specific regulatory mechanisms for sensing and responding to CoM-S-S-CoB heterodisulfide levels .

The data implicates the methylotrophic methanogenesis regulator MsrC (MA4383) in CoM-S-S-CoB heterodisulfide sensing and suggests the existence of a specific mechanism to sense the intracellular ratio of CoM-S-S-CoB to CoM-SH and CoB-SH thiols . This indicates a feed-forward regulation system where substrate availability influences transcript abundance for translation and methanogenesis functions.

How do the enzymatic properties of recombinant HdrE compare to native HdrE in membrane fractions?

When comparing recombinant and native HdrE, several key parameters show notable differences:

ParameterNative HdrERecombinant HdrENotes
Specific activity (nmol min⁻¹ mg⁻¹)Typically higherVariable, often lowerNative enzyme benefits from proper membrane environment
Substrate affinity (Km for CoM-S-S-CoB)Lower (higher affinity)Often higher (lower affinity)Differences in protein folding and cofactor incorporation
pH optimum6.5-7.0Similar rangeGenerally well-preserved in recombinant systems
Temperature stabilityHigherLowerNative membrane environment provides additional stability
Methanophenazine dependencyAbsoluteCan be alteredRecombinant systems may accept alternative electron carriers

To maximize the similarity between recombinant and native HdrE:

  • Express the protein in conditions that mimic the native environment

  • Ensure proper incorporation of iron-sulfur clusters and other cofactors

  • Consider co-expression with HdrD and other interacting partners

  • Reconstitute purified protein into liposomes with native lipid composition

These approaches help preserve the functional properties that are dependent on the membrane environment and protein-protein interactions found in vivo.

What are the most effective purification strategies for recombinant HdrE?

Purifying recombinant HdrE presents unique challenges due to its membrane-associated nature and sensitivity to oxygen. Based on successful protocols with similar proteins, the following strategy is recommended:

  • Cell lysis under strict anaerobic conditions: Use of anaerobic chambers or glove boxes with oxygen scavengers throughout the purification process.

  • Membrane fraction isolation: Differential centrifugation to isolate membrane fractions, followed by selective solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin.

  • Affinity chromatography: Using engineered affinity tags (His-tag, Strep-tag) placed at positions that don't interfere with protein folding or function.

  • Size exclusion chromatography: As a polishing step to obtain homogeneous protein and to analyze the oligomeric state of the purified complex.

  • Cofactor reconstitution: In vitro reconstitution of iron-sulfur clusters under anaerobic conditions if necessary.

Throughout the purification process, it's essential to maintain reducing conditions using agents like dithiothreitol (DTT) or β-mercaptoethanol and to monitor protein integrity using activity assays at each purification step.

How can researchers effectively measure HdrE activity in vitro?

Accurate measurement of HdrE activity requires carefully designed assays that account for its membrane association and specific electron transfer properties:

  • Heterodisulfide reduction assay: Monitor the reduction of CoM-S-S-CoB spectrophotometrically by following the oxidation of an artificial electron donor such as reduced methyl viologen at 578 nm. Alternative assays may use reduced methanophenazine as the physiological electron donor.

  • Proton translocation measurements: Assess the proton-pumping activity using pH-sensitive fluorescent dyes in proteoliposomes reconstituted with purified HdrED complex.

  • Reverse reaction measurements: Measure the oxidation of CoM-SH and CoB-SH to form the heterodisulfide coupled to the reduction of an electron acceptor.

For accurate measurements, consider the following parameters:

  • Strict anaerobic conditions using specialized cuvettes or microplate readers in anaerobic chambers

  • Inclusion of appropriate detergents to maintain protein solubility

  • Addition of stabilizing agents like glycerol or specific lipids

  • Temperature control at physiologically relevant conditions (35-37°C)

  • Inclusion of positive and negative controls to validate assay performance

What genetic tools are available for manipulating hdrE in Methanosarcina species?

Several genetic tools have been developed for manipulating hdrE and other genes in Methanosarcina species:

  • Tetracycline-inducible expression systems: The TetR repressor/operator system allows controlled expression of hdrE. In strain WWM204, the native hdrE promoter shows 401 ± 24 nmol min⁻¹ mg⁻¹ transcriptional fusion reporter activity, whereas the tetracycline-responsive promoter allows for controlled expression .

  • Markerless deletion systems: Using counter-selectable markers like hpt (hypoxanthine phosphoribosyltransferase) for creating clean gene deletions without residual antibiotic resistance markers .

  • Chromosomal integration tools: Recombination at permissive sites such as the hpt locus allows for stable integration of exogenous genes. This approach has been successfully used for complementation studies, as demonstrated when the ech operon was inserted into the M. barkeri hpt locus to complement an ech deletion .

  • Promoter fusion reporters: To monitor gene expression under different conditions or in different genetic backgrounds.

  • CRISPR-Cas9 systems: Recently adapted for use in Methanosarcina species, allowing for more precise genome editing.

When designing genetic manipulations in Methanosarcina, it's important to maintain cells under appropriate selective pressure and to use controls that account for the effects of antibiotics or other selective agents on cell physiology.

How can structural studies of HdrE contribute to understanding methanogens' energy conservation mechanisms?

Structural studies of HdrE can provide critical insights into the energy conservation mechanisms of methanogens through several approaches:

  • Cryo-electron microscopy: Determining the high-resolution structure of the entire HdrED complex within the membrane environment can reveal:

    • The arrangement of transmembrane helices that may form proton-conducting channels

    • Binding sites for methanophenazine and the CoM-S-S-CoB heterodisulfide

    • Conformational changes associated with electron transfer and proton translocation

  • X-ray crystallography: While challenging for membrane proteins, crystallographic studies of soluble domains can provide atomic-level details of catalytic sites.

  • Molecular dynamics simulations: Using structural data to simulate:

    • Proton movement through the complex

    • Binding and release of substrates

    • Conformational changes during the catalytic cycle

These structural insights, combined with biochemical and genetic data, can address fundamental questions about energy conservation in methanogens, such as:

  • The mechanism of proton translocation coupled to heterodisulfide reduction

  • The stoichiometry of protons translocated per heterodisulfide reduced

  • Evolutionary relationships between HdrED and other energy-conserving systems like complex I

These studies may ultimately lead to a unified model of energy conservation in diverse methanogenic pathways.

What are the implications of HdrE research for understanding the evolution of energy conservation in archaea?

Research on HdrE provides valuable insights into the evolution of energy conservation mechanisms in archaea:

  • Comparative genomics: HdrE homologs are found across diverse methanogenic archaea, suggesting this energy conservation mechanism emerged early in archaeal evolution. Sequence analysis reveals that membrane-bound heterodisulfide reductases like HdrED share evolutionary relationships with respiratory complex I (NADH:quinone oxidoreductase) .

  • Functional adaptations: The roles of HdrE in different methanogenic pathways illustrate how a single enzyme complex has been adapted for diverse metabolic contexts—from energy conservation during acetoclastic methanogenesis to providing reduced ferredoxin through reversed electron transport during autotrophic growth .

  • Modular evolution: HdrE represents an example of modular evolution in energy conservation systems. The membrane-bound HdrED complex and the cytoplasmic HdrABC complex both catalyze heterodisulfide reduction but employ different electron donors and have distinct roles in energy conservation.

Future comparative studies across the archaeal domain could reveal how energy conservation mechanisms evolved from ancestral forms to the specialized systems found in modern methanogens, potentially identifying transitional forms and evolutionary intermediates that illuminate the diversification of archaeal energy metabolism.

How might recombinant HdrE be engineered for enhanced stability or activity?

Engineering recombinant HdrE for enhanced stability or activity can be achieved through several rational design and directed evolution approaches:

  • Stability enhancement strategies:

    • Introduction of disulfide bridges at strategic positions to stabilize the tertiary structure

    • Surface entropy reduction by replacing flexible, solvent-exposed residues with alanine

    • Optimization of iron-sulfur cluster binding sites for tighter cofactor association

    • Incorporation of thermostable homolog sequences from hyperthermophilic methanogens

  • Activity enhancement approaches:

    • Rational modification of residues in the substrate binding pocket to improve affinity for CoM-S-S-CoB

    • Engineering the methanophenazine binding site for enhanced electron transfer rates

    • Directed evolution using in vivo selection systems based on methanogen growth rates

    • Creation of chimeric proteins incorporating high-activity domains from related enzymes

  • Protein engineering workflow:

    • Begin with homology modeling based on related structures

    • Identify conserved and variable regions through multiple sequence alignment

    • Generate libraries of targeted mutations at key positions

    • Screen for enhanced activity using high-throughput assays

    • Iteratively combine beneficial mutations

The enhanced variants of HdrE could provide valuable tools for understanding structure-function relationships in this important enzyme and potentially enable new biotechnological applications.

What are the main challenges in expressing and purifying functional recombinant HdrE?

Expressing and purifying functional recombinant HdrE presents several significant challenges:

  • Oxygen sensitivity: HdrE contains iron-sulfur clusters that are extremely sensitive to oxygen damage, requiring strict anaerobic conditions throughout expression and purification .

  • Membrane association: As a membrane protein, HdrE requires detergents or membrane mimetics for solubilization and stability, which can complicate purification procedures and activity assays.

  • Cofactor incorporation: Proper incorporation of iron-sulfur clusters is essential for function but can be inefficient in heterologous expression systems.

  • Protein partner requirements: HdrE functions in a complex with HdrD, and expression of HdrE alone may result in improper folding or aggregation.

  • Codon usage differences: The different codon preferences between M. barkeri and expression hosts like E. coli can lead to translational pausing and improper folding.

To address these challenges, consider implementing:

  • Expression in specialized E. coli strains (e.g., Rosetta for rare codons, SHuffle for disulfide bond formation)

  • Co-expression with iron-sulfur cluster assembly machinery

  • Use of fusion partners to enhance solubility

  • Membrane-targeted expression systems

  • Co-expression with HdrD and other interacting partners

  • Purification in the presence of stabilizing agents like glycerol or specific lipids

How can researchers troubleshoot issues with HdrE activity assays?

When troubleshooting HdrE activity assays, researchers should systematically address several common issues:

ProblemPossible CausesSolutions
Low or no activityOxygen exposureImprove anaerobic techniques; add oxygen scavengers
Cofactor lossReconstitute iron-sulfur clusters; add iron and sulfide
Detergent interferenceTest different detergents; optimize concentrations
Protein denaturationOptimize buffer conditions; add stabilizers
High backgroundNon-enzymatic reductionInclude proper controls without enzyme
Contaminating activitiesImprove purification; add specific inhibitors
Poor reproducibilityVariability in anaerobic conditionsStandardize anaerobic techniques
Batch-to-batch protein variationStandardize expression and purification
Temperature fluctuationsUse temperature-controlled instruments
Substrate limitationsCoM-S-S-CoB availabilitySynthesize or purify fresh substrate
Methanophenazine purityConsider alternative electron donors

Additional troubleshooting strategies:

  • Validate protein integrity by SDS-PAGE and western blotting before assays

  • Confirm iron-sulfur cluster incorporation using UV-visible spectroscopy

  • Test activity under various pH and temperature conditions

  • Include positive controls such as membrane fractions with known activity

  • Consider the effects of buffer components on assay performance

Implementing these strategies can help identify and resolve specific issues affecting HdrE activity measurements.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.