Recombinant Methanosarcina barkeri Putative cobalt transport protein CbiM 2 (cbiM2)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Methanosarcina barkeri Putative Cobalt Transport Protein CbiM 2 (cbiM2) is a key component of the cobalt uptake machinery in the archaeon Methanosarcina barkeri, a methanogen notable for its metabolic versatility. This protein is part of the energy-coupling factor (ECF) transporter family, specifically classified as a group-I cobalt transporter. Its recombinant form enables biochemical and structural studies critical for understanding microbial metal homeostasis and methanogenic pathways .

Role in Cobalt Transport

CbiM2 functions as the substrate-binding subunit (EcfS) of the CbiMNQO transporter complex, a group-I ECF transporter critical for high-affinity cobalt uptake . Key findings include:

  • ATPase Activation: CbiM stimulates ATP hydrolysis by the CbiQO module (basal activity: kcat=2.5min1k_{cat} = 2.5 \, \text{min}^{-1}, Km=277.3μMK_m = 277.3 \, \mu\text{M}) independent of cobalt binding .

  • Substrate Specificity: The transporter exhibits >90% specificity for cobalt over nickel, attributed to residues in the L1 loop (e.g., His2 and His69) that form the substrate-binding pocket . Mutations at these residues abolish transport activity .

Metabolic Relevance

  • Methanogenesis: Cobalt is essential for synthesizing vitamin B12_{12} derivatives, which are cofactors in methyltransferases involved in methane production .

  • Energy Conservation: The CbiMNQO transporter supports intracellular hydrogen cycling, a unique energy-conservation strategy in M. barkeri during acetate metabolism .

Genomic and Regulatory Features

  • Gene Cluster: cbiM2 is part of a cobalt-regulated operon adjacent to B12_{12}-dependent enzymes .

  • Conservation: Homologs of CbiM are widespread in prokaryotes, particularly in microbes reliant on cobalt for anaerobic metabolism .

Biochemical Studies

Recombinant CbiM2 is used to:

  • Characterize cobalt transport kinetics and inhibition.

  • Study ATPase coupling mechanisms in ECF transporters .

References

  1. Creative Biomart. Recombinant Full Length Methanosarcina barkeri Putative Cobalt Transport Protein CbiM 2 .

  2. Mand et al. (2018). The Hydrogen Economy of Methanosarcina barkeri .

  3. Bao et al. (2017). Structure and Mechanism of a Group-I Cobalt ECF Transporter .

  4. Reed et al. (2006). Genome-Scale Metabolic Model of Methanosarcina barkeri .

  5. Kulkarni et al. (2017). Functional Characterization of CbiMNQO .

  6. Cusabio. Recombinant Methanosarcina barkeri CbiM2 .

  7. Rodionov et al. (2006). Comparative Genomic Analysis of Nickel/Cobalt Transporters .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize development accordingly.
Synonyms
cbiM2; Mbar_A2145; Putative cobalt transport protein CbiM 2; Energy-coupling factor transporter probable substrate-capture protein CbiM 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-235
Protein Length
full length protein
Species
Methanosarcina barkeri (strain Fusaro / DSM 804)
Target Names
cbiM2
Target Protein Sequence
MHIMEGYLPAIWCIVWFVVSIPVVAYGVYKLNKLVKEERGILPVLAVAGAFIFVLSSLKM PSVTGSCSHPTGTGIGAIIFGPAITAVLSTIVLIYQALFLAHGGLTTLGANVFSMGIVGP IVAYLIYKTGMKAKLNFYLIVFLAATLGDWATYIVTSTELALAFPAGDILTFGGFFSSFS KFVAIFAITQVPLAIVEGAVSALLFKYIIQAKSDLLVEMKVIGEPLVRKLRGLPA
Uniprot No.

Target Background

Function
Component of the energy-coupling factor (ECF) transporter complex CbiMNOQ, involved in cobalt import.
Database Links
Protein Families
CbiM family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of CbiM2 in Methanosarcina barkeri metabolism?

CbiM2 functions as a putative transmembrane cobalt transport protein that facilitates the uptake of cobalt ions required for the biosynthesis of vitamin B12 derivatives. M. barkeri contains the complete anaerobic pathway for vitamin B12 derivative synthesis, which is essential for its methanogenic metabolism . The genome-scale metabolic model (iAF692) of M. barkeri confirms the presence of this biosynthetic pathway among the organism's 619 total reactions . Cobalt transport represents a critical metabolic function as cobalt is a central component of the corrin ring structure in vitamin B12, which serves as a cofactor for several methyltransferases in the methanogenic pathway.

How does CbiM2 relate to the broader metabolic network of M. barkeri?

CbiM2 supports methanogenesis indirectly by enabling vitamin B12 biosynthesis. M. barkeri is capable of growing on all three major methanogenic substrates (methanol, acetate, and H2/CO2) as well as pyruvate . The metabolic reconstruction model iAF692 identifies 23 reactions in the methanogenic pathway associated with 125 distinct genes . Vitamin B12 derivatives function as cofactors for methyltransferases involved in these pathways, particularly in methanol and acetate utilization. By facilitating cobalt transport, CbiM2 contributes to the synthesis of these essential cofactors, making it an indirect but critical component of M. barkeri's methanogenic capacity and versatile substrate utilization.

How is the cbiM2 gene organized within the M. barkeri genome?

The cbiM2 gene is located within the 4.8 Mb genome of M. barkeri, which contains 5,072 ORFs (Open Reading Frames) . While the precise genomic context is not explicitly detailed in current research, the gene is part of the 692 metabolic genes identified in the iAF692 model that are associated with 509 reactions . The genomic organization likely reflects the biochemical relationship between cobalt transport and vitamin B12 biosynthesis. In typical prokaryotic systems, cobalt transporter genes are often organized in operons containing additional components of the transport system (such as CbiQ, CbiO, and CbiN), suggesting similar organization may exist for cbiM2 in M. barkeri.

What experimental evidence confirms CbiM2's role in cobalt transport?

Confirming CbiM2's role as a cobalt transporter requires multiple experimental approaches. The iAF692 metabolic model of M. barkeri has demonstrated high predictive accuracy for growth phenotypes of both wild-type and mutant strains (13 out of 14 cases showed agreement between model predictions and experimental data) . Similar experimental validation approaches could be applied to characterize CbiM2 function, including:

  • Gene deletion studies to observe effects on cobalt uptake and vitamin B12 biosynthesis

  • Heterologous expression in cobalt transport-deficient strains

  • Radioactive cobalt (60Co) uptake assays

  • Metal binding assays using purified protein

  • Growth studies under varying cobalt concentrations

What are the most effective expression systems for recombinant CbiM2?

Expressing recombinant CbiM2 presents challenges due to its archaeal origin and membrane protein nature. The most effective approaches include:

  • E. coli-based expression systems:

    • BL21(DE3) strains with archaeal codon optimization

    • C41/C43 strains specifically designed for membrane protein expression

    • Co-expression with archaeal chaperones to facilitate proper folding

  • Archaeal expression hosts:

    • Homologous expression in M. barkeri (more technically challenging)

    • Heterologous expression in related archaeal species with established genetic tools

  • Expression optimization parameters:

    • Lower induction temperatures (16-25°C) to reduce inclusion body formation

    • Extended expression periods with lower inducer concentrations

    • Specialized media formulations with defined cobalt concentrations

The metabolic reconstruction of M. barkeri indicates multiple enzyme complexes (65 reported in the model) , suggesting that CbiM2 may function as part of a multicomponent transport system, which would influence expression strategy selection.

What purification strategies are most effective for CbiM2?

Purification of membrane transport proteins like CbiM2 requires specialized approaches:

Purification StepRecommended MethodologyConsiderations
Membrane isolationDifferential centrifugationRequires careful optimization for archaeal membranes
SolubilizationDetergent screening (DDM, LMNG, MNG-3)Detergent selection critical for maintaining function
Affinity purificationIMAC using His-tagTag position (N- or C-terminal) may affect function
Size exclusionSuperdex 200Detergent micelle contributes to apparent size
Functional verificationCobalt binding assaysEssential to confirm activity post-purification

For structural studies, additional purification considerations include detergent exchange, lipid supplementation, and assessment of conformational homogeneity. The presence of 558 distinct metabolites in the M. barkeri metabolic network suggests that specific cofactors or small molecules may be important for CbiM2 stability during purification.

How can researchers effectively assess cobalt transport activity of purified CbiM2?

Functional characterization of CbiM2's cobalt transport capabilities requires multiple complementary approaches:

  • Liposome reconstitution assays:

    • Purified CbiM2 reconstituted into liposomes with defined lipid composition

    • Establish ion gradients relevant to archaeal physiology

    • Measure cobalt uptake using atomic absorption spectroscopy or ICP-MS

    • Include control liposomes without protein to account for passive diffusion

  • Metal binding characterization:

    • Isothermal titration calorimetry (ITC) to determine binding affinity and stoichiometry

    • Fluorescence spectroscopy with metal-sensitive fluorophores

    • Equilibrium dialysis with radioactive cobalt

    • Competitive binding assays with other divalent metals

  • Structure-function analysis:

    • Site-directed mutagenesis of predicted metal-binding residues

    • Assessment of transport activity in reconstituted systems

    • Correlation with structural data when available

The genome-scale metabolic model of M. barkeri has been successfully used to predict phenotypes under different genetic and environmental conditions , suggesting that similar approaches could be used to predict the impact of manipulating cobalt transport on cellular metabolism.

What role does CbiM2 play in energy conservation during methanogenesis?

Energy conservation is a critical aspect of methanogenic metabolism. The iAF692 model of M. barkeri specifically examined "the efficiency of the energy-conserving reactions in the methanogenic pathway, specifically the Ech hydrogenase reaction" . While CbiM2 is not directly involved in energy conservation, its role in cobalt transport indirectly supports energy metabolism through vitamin B12-dependent reactions.

The energetics of CbiM2-mediated cobalt transport may involve:

Understanding these mechanisms requires:

  • Measurement of transport activity under different energetic conditions

  • Assessment of ATP or ion requirements for transport

  • Integration with the broader energy metabolism of M. barkeri

The metabolic model indicates that M. barkeri contains six energy-conserving ion translocating enzymes in its methanogenic pathway , suggesting that energy coupling is critical for the organism's metabolism and may extend to transport processes like cobalt uptake.

How does cobalt limitation affect the expression and function of CbiM2?

Cobalt limitation likely triggers regulatory responses affecting CbiM2 expression. While specific regulatory mechanisms for CbiM2 are not detailed in current research, investigation approaches include:

  • Transcriptional analysis under defined cobalt conditions:

    • RT-qPCR to measure cbiM2 mRNA levels

    • RNA-seq to identify co-regulated genes in the cobalt limitation response

    • Promoter analysis to identify regulatory elements

  • Proteomics approaches:

    • Quantitative proteomics to measure CbiM2 protein levels

    • Phosphoproteomics to identify post-translational modifications

    • Protein-protein interaction studies to identify regulatory partners

  • Physiological assessments:

    • Growth kinetics under cobalt limitation

    • Vitamin B12 synthesis quantification

    • Methanogenesis rates on different substrates

These investigations would complement the existing metabolic model, which has been used to examine substrate utilization and genetic knockouts . The model could be extended to predict cellular responses to varying cobalt availability.

What structural biology techniques are most promising for resolving CbiM2's transport mechanism?

Understanding the structural basis of CbiM2-mediated cobalt transport requires multi-faceted approaches:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for high-resolution structure determination

    • Visualization of different conformational states during transport

    • Particularly valuable for membrane protein complexes

  • X-ray crystallography:

    • Lipidic cubic phase crystallization for membrane proteins

    • Heavy atom derivatization using cobalt to identify binding sites

    • Crystal optimization with antibody fragments or nanobodies

  • Spectroscopic methods:

    • Electron paramagnetic resonance (EPR) for cobalt coordination analysis

    • Fluorescence resonance energy transfer (FRET) for conformational dynamics

    • Nuclear magnetic resonance (NMR) for ligand binding studies

  • Computational approaches:

    • Homology modeling based on related transporters

    • Molecular dynamics simulations to study ion permeation

    • Quantum mechanical calculations for metal coordination chemistry

The metabolic reconstruction of M. barkeri has already provided valuable insights into the organism's biochemistry , and structural studies of CbiM2 would further enhance our understanding of the molecular mechanisms underlying cobalt transport and utilization.

How can mutational analysis illuminate functional domains in CbiM2?

Systematic mutational analysis can reveal key functional regions of CbiM2:

  • Targeted mutagenesis approaches:

    • Alanine scanning of transmembrane regions

    • Conservative and non-conservative substitutions of predicted metal-binding residues

    • Chimeric proteins with homologous transporters to identify specificity determinants

  • Functional assays for mutant characterization:

    • Transport activity measurements in reconstituted systems

    • Metal binding assays to assess direct effects on cobalt coordination

    • Complementation studies in transport-deficient strains

  • Structure-guided mutagenesis:

    • Mutations based on computational structural predictions

    • Evolutionary conservation analysis to prioritize targets

    • Cross-linking studies to identify interacting residues

The iAF692 metabolic model could help predict the phenotypic consequences of disrupting cobalt transport on vitamin B12 synthesis and downstream metabolic pathways , providing context for interpreting mutational data.

How can CbiM2 function be integrated into genome-scale metabolic models of M. barkeri?

The existing iAF692 genome-scale metabolic model of M. barkeri provides a foundation for integrating CbiM2 function:

  • Enhanced transport reaction representation:

    • Explicit incorporation of cobalt transport reactions

    • Linking transport to gene-protein-reaction (GPR) associations

    • Implementation of regulatory constraints based on experimental data

  • Flux balance analysis applications:

    • Prediction of growth phenotypes under varying cobalt availability

    • Simulation of cbiM2 deletion or overexpression effects

    • Identification of alternate routes for cobalt acquisition

  • Model validation and refinement:

    • Experimental testing of model predictions regarding cobalt dependence

    • Iterative refinement based on experimental results

    • Extension to include detailed vitamin B12 biosynthesis pathways

The iAF692 model has already demonstrated high predictive accuracy for methanogenic pathway mutants (13 out of 14 cases showed agreement with experimental data) , suggesting that similar approaches would be valuable for studying cobalt transport.

What comparative genomics approaches can reveal about CbiM2 evolution across methanogenic archaea?

Comparative analysis can provide evolutionary insights into CbiM2 function:

  • Homology analysis across archaea:

    • Identification of CbiM homologs in diverse methanogenic species

    • Analysis of sequence conservation patterns

    • Correlation with methanogenic capabilities and ecological niches

  • Gene neighborhood analysis:

    • Examination of genomic context and operon structure

    • Identification of co-evolved components (CbiQ, CbiO, CbiN)

    • Horizontal gene transfer assessment

  • Phylogenetic reconstruction:

    • Evolutionary history of cobalt transporters in methanogens

    • Comparison with evolution of vitamin B12 biosynthesis pathways

    • Correlation with substrate utilization capabilities

The comparative analysis in the search results indicates that M. barkeri's metabolic network shares only 25.2% of metabolites and 12.6% of reactions with networks from other domains of life , highlighting the unique aspects of archaeal metabolism that may extend to cobalt transport systems.

How can longitudinal studies improve our understanding of CbiM2 regulation?

Longitudinal studies of CbiM2 expression and function can reveal dynamic regulatory patterns:

  • Time-course experimental designs:

    • Monitoring cbiM2 expression during growth phase transitions

    • Tracking changes in response to cobalt availability fluctuations

    • Assessing adaptation to different methanogenic substrates

  • Statistical analysis approaches:

    • Time-series analysis methods for identifying regulatory patterns

    • Longitudinal data analysis to account for temporal correlations

    • Integration with metabolic modeling for flux predictions

  • Data integration strategies:

    • Combining transcriptomic, proteomic, and metabolomic measurements

    • Correlation analysis between cobalt transport, vitamin B12 synthesis, and methanogenesis

    • Network analysis to identify regulatory relationships

The search results mention q2-longitudinal, a software plugin for longitudinal analysis that could be adapted for analyzing time-course data , providing valuable tools for studying the dynamic regulation of CbiM2.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.