Recombinant Methanosarcina mazei CoB--CoM heterodisulfide reductase 2 subunit E (hdrE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage state, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
hdrE; MM_1843; Dihydromethanophenazine:CoB--CoM heterodisulfide reductase subunit E; CoB--CoM heterodisulfide reductase subunit E; Coenzyme B:coenzyme M:methanophenazine oxidoreductase subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) (Methanosarcina frisia)
Target Names
hdrE
Target Protein Sequence
MAYFSGLSDALRLTFVQIMILSAIAVVIFLYGMIGNFQKWGAGVTGYALEPPTGKKGSAI RFLKTWWAQVRAESHHHGKPILEVLILDIFFQRRILKRSPIRWFMHFTIFAGWMSLFALS GLMFAVEMTEKIGIELPFTPAEFREMLSLPNYIFGYILLIGVMIAVVRRLFVSEVREASI MYDWVLLGGVFIVTISGFIADGIRTGIIWGFGLDPVTAPPAALFHSVISLLFCIAYIPYS KYIHVIATPLAILANKGGE
Uniprot No.

Target Background

Function
This protein is part of a complex that catalyzes the reversible reduction of CoM-S-S-CoB to the thiol-coenzymes H-S-CoM (coenzyme M) and H-S-CoB (coenzyme B). HdrE may play a role in anchoring the complex to the membrane.
Database Links

KEGG: mma:MM_1843

STRING: 192952.MM_1843

Protein Families
HdrE family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanosarcina mazei CoB--CoM heterodisulfide reductase 2 subunit E (hdrE) and what is its role in methanogenesis?

HdrE is a critical subunit of the membrane-bound heterodisulfide reductase complex (HdrED) in Methanosarcina mazei, a metabolically versatile methanogenic archaeon. This enzyme catalyzes the reduction of the CoM-S-S-CoB heterodisulfide, regenerating the thiol forms of coenzyme M (CoM-SH, mercaptoethane sulfonate) and coenzyme B (CoB-SH, 7-mercaptoheptanoylthreonine phosphate) that are essential for subsequent rounds of methanogenesis . The enzyme serves as the terminal oxidoreductase in the electron transport chain of Methanosarcina species, using reduced methanophenazine as an electron donor . This reaction is coupled to proton translocation across the cell membrane, generating a proton gradient that is harnessed by ATP synthase for energy conservation, making HdrE critically important for both metabolic function and energy generation in these organisms .

What is the molecular structure of hdrE in Methanosarcina mazei?

HdrE from Methanosarcina mazei is a membrane-bound protein consisting of 259 amino acids, as indicated by its protein sequence . The protein contains multiple transmembrane helices consistent with its role as a membrane-integrated component. According to the amino acid sequence data, the full protein contains regions with hydrophobic character typical of membrane-spanning domains, along with more hydrophilic regions that likely interact with the cytoplasmic environment . The protein contains several notable structural features including predicted helical regions that facilitate membrane integration and potentially contribute to interactions with other subunits of the heterodisulfide reductase complex. While high-resolution structural data is limited, sequence analysis suggests that hdrE contains domains involved in electron transfer and substrate binding necessary for its function in methanogenesis .

How can recombinant hdrE be characterized biochemically?

The biochemical characterization of recombinant hdrE typically employs several complementary approaches:

  • Enzyme Activity Assays: Measuring the reduction of CoM-S-S-CoB using artificial electron donors like reduced methyl viologen or physiological electron donors such as reduced methanophenazine.

  • Spectroscopic Analysis: Examining cofactor content and redox properties using UV-visible, EPR, and resonance Raman spectroscopy.

  • Protein-Protein Interaction Studies: Determining interactions with other Hdr subunits through co-immunoprecipitation, cross-linking studies, or surface plasmon resonance.

  • Membrane Integration Analysis: Assessing membrane association through subcellular fractionation and protease accessibility assays.

To ensure proper folding and activity of recombinant hdrE, it's essential to verify the presence of the correct prosthetic groups and test activity under anaerobic conditions that mimic the native environment of methanogens . Purification should be conducted under strict anaerobic conditions to preserve enzyme integrity, and the purified protein should be immediately characterized as oxidation can rapidly inactivate the enzyme.

What expression systems are available for producing recombinant hdrE?

There are two main approaches for producing recombinant hdrE:

Homologous Expression in Methanosarcina mazei:
A more effective approach uses an inducible protein production system directly in M. mazei. This system employs the p1687 promoter, which controls the transcription of methyltransferases involved in methylamine demethylation . The promoter remains inactive during growth on methanol but is rapidly activated when trimethylamine is added to the medium, allowing controlled expression of the target protein . This system can be used to produce Strep-tagged proteins for subsequent purification by affinity chromatography, as demonstrated with β-glucuronidase as a model protein .

The homologous expression approach offers significant advantages for producing functional hdrE since it provides the native cellular environment, appropriate cofactors, and post-translational modifications that may be required for proper folding and activity.

What genetic tools are available for studying hdrE function in Methanosarcina mazei?

Several genetic tools have been developed for studying protein function in Methanosarcina mazei:

  • Inducible Expression Systems: The p1687 promoter system allows controlled expression of recombinant proteins, including those fused to affinity tags for purification .

  • Selectable Markers:

    • Puromycin resistance has traditionally been the primary selectable marker

    • Neomycin resistance has been established as a second selectable marker through specially designed plasmids

  • Plasmid Vectors: The plasmid pWM321 has been adapted for use in M. mazei, allowing for introduction of recombinant genes .

  • Reporter Systems: β-glucuronidase from E. coli has been successfully used as a reporter to monitor promoter activity in M. mazei .

These tools enable various experimental approaches including:

  • Gene knockout and complementation studies

  • Protein overexpression and depletion studies

  • Promoter activity analysis

  • Protein tagging for localization and interaction studies

The availability of two selectable markers (puromycin and neomycin resistance) expands the possibilities for genetic manipulation, allowing the construction of more complex genetic systems and facilitating the study of essential genes like hdrE .

How does hdrE expression change under different growth conditions?

The expression of hdrE in Methanosarcina species shows significant regulation under different growth conditions and metabolic states:

Growth ConditionhdrE ExpressionPhysiological Context
Exponential PhaseBaseline expressionActive energy metabolism
Stationary Phase1.37-fold upregulationAdaptation to nutrient limitation
Methanol as substrateModerate expressionMethylotrophic methanogenesis
H₂/CO₂ as substrateAltered expressionHydrogenotrophic pathway activation
Acetate as substrateAltered expressionAcetoclastic pathway utilization

The differential expression of hdrE and related genes across different substrates indicates that M. mazei and related species adjust their methanogenic machinery according to available energy sources . Gene expression studies have shown that substrate-specific transcriptional regulators may be involved in controlling the expression of hdrE and related genes in the methanogenic pathway .

The upregulation of hdrE during stationary phase suggests its importance in maintaining energy conservation under resource-limited conditions, potentially allowing the cell to maximize energy yield from the available substrates . This adaptive response highlights the central role of hdrE in methanogen bioenergetics.

What regulatory mechanisms control heterodisulfide reductase expression in methanogens?

The regulation of heterodisulfide reductase genes, including hdrE, involves several sophisticated mechanisms:

  • Substrate-Specific Regulation: Recent research has identified a novel regulator, HdrR, which specifically activates the transcription of the heterodisulfide reductase hdrBCA operon in the related organism Methanosarcina barkeri . HdrR contains a helix-turn-helix domain involved in DNA binding and can bind directly to the hdrBCA operon promoter to regulate transcription . While this specific mechanism controls the cytoplasmic HdrABC rather than the membrane-bound HdrED complex, it establishes a precedent for specific transcriptional regulation of heterodisulfide reductases in methanogens.

  • Growth Phase-Dependent Regulation: The expression of hdrE shows growth phase-dependent regulation, with upregulation (1.37-fold) observed during the stationary phase in Methanosarcina . This suggests the involvement of global regulators that respond to nutrient availability and energy status.

  • Feedback Regulation: There appears to be a complex interplay between CoM-S-S-CoB/CoM-SH + CoB-SH metabolite pools and ATP concentrations in regulating gene expression . The depletion of HdrED leads to an imbalance in these metabolite pools and collapse of the transmembrane proton gradient, triggering widespread changes in gene expression .

  • Coordinated Regulation with Methanogenesis Genes: Transcriptomic analyses have revealed that 55% of genes regulated by HdrED depletion also show growth phase-dependent regulation, indicating tight coupling between HdrED-dependent gene regulation and general metabolic processes . This suggests the existence of coordinated regulatory networks that maintain stoichiometric relationships between different components of the methanogenic pathway.

These regulatory mechanisms ensure that methanogens can adjust their energy conservation strategies according to environmental conditions and substrate availability, optimizing their metabolic efficiency in changing environments.

What happens to methanogen metabolism when hdrE/HdrED is depleted?

Depletion of the HdrED complex, which includes the hdrE subunit, triggers profound metabolic and transcriptional changes in methanogens:

  • Metabolite Imbalance: Immediate imbalance in CoM-S-S-CoB/CoM-SH + CoB-SH metabolite pools occurs, disrupting the central methanogenic pathway .

  • Energy Crisis: Collapse of the transmembrane proton gradient leads to reduced ATP synthesis, creating an energy crisis in the cell .

  • Transcriptional Reprogramming: Of 4,433 genes in Methanosarcina acetivorans, 676 showed changes in gene expression upon HdrED depletion . Among these, 440 were also regulated by growth phase, indicating a 55% positive correlation between growth phase and HdrED-dependent gene regulation .

  • Upregulation of Alternative Pathways: Transcripts for methyltransferases (mtaC2, mtaB3, mtaC3) increase, potentially representing an attempt to maintain carbon flow through alternative pathways .

  • Time-Dependent Response: 227 genes showed time-dependent trends in transcript abundance during HdrED depletion, indicating a dynamic response to the changing metabolic state .

How can site-directed mutagenesis approaches be used to investigate the functional domains of hdrE?

Site-directed mutagenesis offers a powerful approach for investigating structure-function relationships in hdrE. Based on sequence analysis and predicted functional domains, several methodological approaches can be employed:

  • Targeting Membrane-Spanning Regions:

    • Introduce mutations in predicted transmembrane helices to assess their role in membrane integration

    • Replace hydrophobic residues with charged amino acids to disrupt membrane association

    • Analyze the impact of these mutations on protein localization and complex formation

  • Investigating Cofactor Binding Sites:

    • Identify conserved residues likely involved in binding prosthetic groups

    • Create alanine substitutions at these positions to assess impact on cofactor binding

    • Measure spectroscopic properties of mutant proteins to confirm alterations in cofactor environment

  • Probing Subunit Interfaces:

    • Target residues at predicted interfaces between hdrE and other subunits

    • Introduce mutations that alter charge, hydrophobicity, or steric constraints

    • Assess effects on complex formation and stability through co-purification studies

  • Examining Proton Translocation Pathway:

    • Identify residues potentially involved in proton transfer

    • Create conservative and non-conservative substitutions

    • Measure effects on proton translocation efficiency and coupling to electron transfer

The most effective approach would utilize the homologous expression system in M. mazei with the inducible p1687 promoter . This allows controlled expression of mutant proteins in their native environment, where they can be evaluated for proper folding, complex formation, and enzymatic activity. The Strep-tag fusion approach enables efficient purification of the mutant proteins for detailed biochemical and biophysical characterization .

How does the hdrE subunit from Methanosarcina mazei compare with homologous proteins from other methanogens?

Comparative analysis of hdrE across methanogen species reveals important evolutionary and functional insights:

SpecieshdrE Homology to M. mazeiKey DifferencesMetabolic Implications
M. barkeriHigh (>90% identity)Minor variations in membrane-spanning regionsSimilar substrate utilization
M. acetivoransHigh (>85% identity)Variations in cytoplasmic loopsAdapted for acetoclastic methanogenesis
Methanothermobacter speciesModerate (~50-60% identity)More compact structure, thermostable featuresAdaptation to thermophilic environments
Methanococcus speciesLow (~30-40% identity)Different membrane topologySpecialized for marine environments

The heterodisulfide reductase system shows interesting evolutionary adaptations across different lineages of methanogens. While the membrane-bound HdrED type (containing hdrE) is characteristic of Methanosarcina species, some methanogens utilize a cytoplasmic HdrABC type instead . The distribution of these different types correlates with metabolic capabilities and ecological niches.

In Methanosarcina species, which possess both HdrED and HdrABC systems, the regulation of these two enzyme complexes appears to involve different mechanisms. The cytoplasmic HdrABC is regulated by the transcription factor HdrR in M. barkeri , while the membrane-bound HdrED (containing hdrE) shows growth phase-dependent regulation in M. acetivorans .

The conservation of key functional domains across diverse methanogen species underscores the essential role of heterodisulfide reductases in methanogen energy conservation, while variations in specific residues and regulatory mechanisms reflect adaptations to different environmental conditions and metabolic strategies.

What are the best approaches for purifying active recombinant hdrE for functional studies?

Purification of active recombinant hdrE requires specialized approaches that preserve the integrity of this membrane protein and its associated cofactors:

  • Expression Strategy:

    • The homologous expression system in M. mazei using the inducible p1687 promoter is recommended

    • A Strep-tag fusion allows for efficient single-step affinity purification

    • Expression should be optimized by monitoring promoter activity in response to trimethylamine induction

  • Membrane Extraction:

    • All procedures should be performed under strictly anaerobic conditions

    • Cells should be harvested in mid-logarithmic phase to maximize protein yield

    • Gentle lysis methods (e.g., osmotic shock, mild detergent treatment) help preserve membrane integrity

    • Various detergents (DDM, Triton X-100, CHAPS) should be screened to identify optimal solubilization conditions

  • Affinity Purification Protocol:

    • Use Strep-Tactin columns equilibrated with appropriate buffer containing the selected detergent

    • Include reducing agents (e.g., DTT, β-mercaptoethanol) to prevent oxidation of thiol groups

    • Elute with desthiobiotin in anaerobic buffer

    • Immediately proceed to activity assays or further characterization

  • Quality Control:

    • Verify protein purity by SDS-PAGE and Western blot

    • Confirm membrane association and proper folding by circular dichroism

    • Assess cofactor content by UV-visible spectroscopy

    • Measure specific activity using standard heterodisulfide reductase assays

This approach has been successfully applied for other Strep-tagged proteins expressed in M. mazei, with proteins purified in active form by affinity chromatography . The key advantage is that proteins expressed in their native organism are more likely to contain the correct cofactors and post-translational modifications required for activity.

How can global transcriptomic approaches be used to understand the metabolic impact of hdrE?

Global transcriptomic approaches provide powerful insights into the metabolic significance of hdrE:

  • Experimental Design for hdrE Depletion Studies:

    • Utilize a tetracycline-responsive TetR repressor system to control hdrE expression

    • Compare transcriptomes with inducer (tetracycline) present or absent

    • Collect samples at multiple time points to capture dynamic responses

    • Include both exponential and stationary phase cultures to distinguish growth phase effects

  • RNA-Seq Analysis Workflow:

    • Extract total RNA under anaerobic conditions to prevent oxidative damage

    • Prepare strand-specific libraries with rRNA depletion

    • Sequence to sufficient depth (>20 million reads per sample)

    • Align reads to the reference genome and quantify transcript abundance

    • Identify differentially expressed genes using statistical tools (e.g., DESeq2, edgeR)

  • Data Integration and Interpretation:

    • Group differentially expressed genes by functional categories and metabolic pathways

    • Perform time-course analysis to identify immediate vs. adaptive responses

    • Compare with growth phase-dependent changes to distinguish specific hdrE effects

    • Use clustering approaches to identify co-regulated gene modules

  • Validation Approaches:

    • Confirm key findings with RT-qPCR

    • Correlate transcriptomic changes with metabolite profiles

    • Test predictions through targeted genetic manipulations

Previous research has revealed that HdrED depletion affects hundreds of genes, with 55% correlation between growth phase and HdrED-dependent regulation . This approach has identified specific metabolic adaptations, including upregulation of methyltransferases and time-dependent trends in the expression of 227 genes . Such comprehensive analyses can reveal the broader metabolic roles of hdrE beyond its direct catalytic function.

What experimental systems can be used to study the interaction between hdrE and other components of the methanogenic electron transport chain?

Several experimental approaches can be employed to investigate the interactions between hdrE and other components of the methanogenic electron transport chain:

  • Co-Immunoprecipitation and Pull-Down Assays:

    • Express Strep-tagged hdrE in M. mazei using the inducible p1687 promoter system

    • Perform pull-down experiments using Strep-Tactin resin

    • Identify interacting proteins by mass spectrometry

    • Validate interactions through reciprocal tagging and pull-down experiments

  • Membrane Reconstitution Studies:

    • Purify individual components (hdrE, hdrD, methanophenazine)

    • Reconstitute in liposomes with defined composition

    • Measure electron transfer rates and coupling to proton translocation

    • Systematically vary component ratios to determine optimal stoichiometry

  • Crosslinking Approaches:

    • Use membrane-permeable crosslinkers in intact cells

    • Apply MS-compatible crosslinkers for structural analysis

    • Employ photo-activatable crosslinkers for capturing transient interactions

    • Analyze crosslinked products by SDS-PAGE and mass spectrometry

  • Genetic Interaction Studies:

    • Create conditional depletion strains for multiple components

    • Analyze epistatic relationships through growth and transcriptomic analysis

    • Use the neomycin resistance marker for constructing double mutants

    • Measure metabolic flux changes using isotope labeling

These approaches can reveal both the static structure of protein complexes and the dynamic interactions that occur during electron transfer. By combining these methods, researchers can build a comprehensive model of how hdrE functions within the larger context of methanogen energy metabolism and identify potential targets for modulating methanogenesis.

How might the study of hdrE contribute to climate change mitigation strategies?

The study of hdrE has significant implications for climate change mitigation due to methanogens' major contribution to global methane emissions:

  • Targeted Inhibition Strategies:

    • Understanding the structure and function of hdrE can guide the development of specific inhibitors

    • Since HdrED serves as a terminal oxidoreductase in the electron transport chain, its inhibition could effectively halt methanogenesis

    • Rational design of inhibitors based on the CoM-S-S-CoB binding site could provide tools for reducing methane emissions from agricultural sources

  • Bioengineering Applications:

    • Manipulation of hdrE expression or activity could redirect carbon flux in methanogens

    • Engineering strains with modified hdrE could enhance methane production for biogas applications or reduce methane emissions in agricultural settings

    • Creating conditional hdrE expression systems could allow temporal control of methanogenesis

  • Environmental Monitoring:

    • hdrE gene abundance and expression could serve as biomarkers for methanogenic potential in environmental samples

    • Molecular tools targeting hdrE could help predict methane emission rates from various ecosystems

    • Monitoring changes in hdrE diversity could track shifts in methanogen communities under changing climate conditions

As noted in recent research, "reducing methane emissions is crucial to meeting set climate goals" and "the methanogenic activity of certain microorganisms can be drastically reduced by inhibiting the transcription of the hdrBCA operon" . Similar principles could apply to the HdrED complex containing hdrE, making it a valuable target for climate mitigation strategies.

What are the challenges and opportunities in studying the structure-function relationship of hdrE?

Research into the structure-function relationship of hdrE faces several challenges but also presents significant opportunities:

Challenges:

  • Membrane Protein Crystallization:

    • Obtaining high-resolution structural data is difficult due to the membrane-bound nature of hdrE

    • Traditional crystallization approaches often fail with membrane proteins

    • Detergent selection critically impacts protein stability and crystallization potential

  • Anaerobic Requirements:

    • All structural and functional studies must be performed under strictly anaerobic conditions

    • Special equipment and expertise are required for handling oxygen-sensitive proteins

    • Cofactors may be lost or modified during purification, affecting functional studies

  • Complex Formation:

    • hdrE functions as part of a multi-subunit complex, complicating structural studies

    • Interactions with other subunits may be essential for proper folding and function

    • The dynamic nature of electron transfer complexes poses challenges for structural characterization

Opportunities:

  • Emerging Structural Techniques:

    • Cryo-electron microscopy circumvents many challenges of membrane protein crystallization

    • Lipid cubic phase crystallization methods have proven successful for other membrane proteins

    • Solid-state NMR techniques can provide structural information in membrane environments

  • Computational Approaches:

    • Homology modeling using related proteins as templates can provide initial structural insights

    • Molecular dynamics simulations can reveal dynamic aspects of protein function

    • AI-based structure prediction tools like AlphaFold2 offer new possibilities for predicting membrane protein structures

  • Integration of Multiple Methods:

    • Combining low-resolution structural data with site-directed mutagenesis can map functional domains

    • Cross-linking mass spectrometry can provide constraints for structural modeling

    • Hydrogen-deuterium exchange mass spectrometry can probe dynamic regions and ligand interactions

Advances in these areas create unprecedented opportunities to unravel the structural basis of hdrE function, potentially leading to applications in biotechnology and climate change mitigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.