Recombinant Methanosarcina mazei Protease HtpX homolog 1 (htpX1)

Shipped with Ice Packs
In Stock

Description

Functional Characteristics

HtpX1 belongs to the HtpX family of proteases, which are implicated in:

  • Protein degradation: Cleavage of misfolded or damaged proteins .

  • Zinc dependency: Enzymatic activity requires Zn²⁺ supplementation .

  • Self-cleavage: Demonstrated in E. coli HtpX under zinc-rich conditions .

ActivitySubstrateConditionsOutcome
ProteolysisCaseinZn²⁺ supplementationDegradation observed
Membrane protein cleavageSecY (solubilized)Zn²⁺ supplementationCleavage confirmed in vivo
Self-cleavageRecombinant HtpXZn²⁺ supplementationAutodegradation detected

While direct experimental data for M. mazei HtpX1 is limited, its homology to E. coli HtpX suggests analogous roles in membrane protein quality control .

Expression and Purification

Recombinant HtpX1 is purified via His-tag affinity chromatography. Its stability is optimized in trehalose-containing buffers to prevent aggregation . Reconstitution is recommended at 0.1–1.0 mg/mL with glycerol (5–50%) for long-term storage .

Proteolytic System Context

In M. mazei, proteolytic systems like the proteasome-PAN complex are well-studied. PAN (proteasome-activating nucleotidase) activates proteasome-mediated degradation, while HtpX1 may function in complementary pathways . Structural analyses of M. mazei proteasomes reveal a 15 nm height and 11 nm diameter, distinct from PAN complexes .

Regulatory Insights

Transcriptomic studies in M. mazei highlight nitrogen-dependent regulation of small ORFs (sORFs), though HtpX1-specific regulation remains unexplored . Homologs in E. coli are stress-activated, suggesting potential environmental responsiveness in M. mazei .

Comparative Analysis with E. coli HtpX

FeatureM. mazei htpX1E. coli HtpX
LocalizationPredicted membrane-associated Membrane-bound
Catalytic metalZinc-dependent (predicted) Zinc-dependent
Substrate specificityCasein, SecY analogs (inferred) Casein, SecY, self-cleavage
RegulationUnknown (stress-activated?) Stress-induced

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
htpX1; MM_1236; Protease HtpX homolog 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) (Methanosarcina frisia)
Target Names
htpX1
Target Protein Sequence
MKNMLKTTVLLAALTGLLVIIGDYFGGTGGMIIAFLFAVVLNFGSYWYSDKIVLKMYRAK EVSPAEAPNLHRIVDGLVMKAGIPKPKVYIVQSGMPNAFATGRDPKHAAVAATTGILELL SYEEMEGVLAHELAHVKNRDTLISAIAATLAGVVTMLAHWAQWAAIFGGFGGRDDDGNGG IVGLIAMAIVAPIAATLIQLAISRSREFAADEEGARISRKPWALADALEKLEYGNSHYRA RVSDVQAKESSAHMFIVNPLKGGAVQSLFRTHPVTDERVRRLRAMKF
Uniprot No.

Target Background

Database Links

KEGG: mma:MM_1236

STRING: 192952.MM_1236

Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is recombinant M. mazei htpX1 typically expressed and purified?

Recombinant M. mazei htpX1 is typically expressed in E. coli expression systems with an N-terminal His-tag for purification purposes . The standard expression protocol involves:

  • Transformation of the expression vector containing the htpX1 gene into a suitable E. coli strain

  • Cultivation of transformed cells under optimized conditions

  • Induction of protein expression

  • Cell harvesting and lysis

  • Purification by metal affinity chromatography

The commercially available recombinant htpX1 protein is supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE . For research applications, the protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage at -20°C/-80°C .

What are the recommended storage and handling conditions for recombinant htpX1?

For optimal stability and activity, recombinant htpX1 should be:

ParameterRecommendation
Storage temperature-20°C/-80°C upon receipt
BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
AliquotingNecessary for multiple use to avoid freeze-thaw cycles
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Preservative5-50% glycerol (50% recommended for long-term storage)
HandlingBrief centrifugation prior to opening; avoid repeated freeze-thaw cycles

Working aliquots can be stored at 4°C for up to one week . The protein's activity is sensitive to repeated freeze-thaw cycles, which should be minimized to maintain functional integrity.

What is the proposed biological function of htpX1 in M. mazei?

As a member of the M48 family of zinc metalloproteinases, htpX1 in M. mazei is proposed to function in membrane protein quality control, similar to its homolog in E. coli . Specifically, it is believed to:

  • Participate in the degradation of misfolded or damaged membrane proteins

  • Contribute to proteolytic processing of specific membrane proteins

  • Play a role in stress response pathways, particularly under conditions that compromise membrane protein integrity

Proteomic analysis of M. mazei reveals that htpX1 exists in a cellular context rich with post-translationally modified proteins . This suggests that htpX1 may function within a complex network of protein modification and quality control machinery specific to the archaeal membrane environment. Its precise substrates in M. mazei have not been definitively identified, though insights from E. coli HtpX studies suggest involvement in membrane protein homeostasis .

How can I design an effective assay to measure htpX1 protease activity?

Based on methodologies developed for E. coli HtpX, an effective assay for M. mazei htpX1 could utilize a model substrate approach. A semiquantitative and convenient in vivo protease activity assay has been established for E. coli HtpX that could be adapted for htpX1 .

Key components of such an assay include:

  • Construct design: Creating a fusion protein containing:

    • A reporter domain (e.g., GFP or β-glucuronidase)

    • A linker region containing the putative cleavage site

    • A targeting sequence to ensure correct membrane localization

  • Expression system: While E. coli could be used as a heterologous host, a homologous expression system in M. mazei would provide more physiologically relevant results. An inducible expression system for M. mazei, such as the one based on the p1687 promoter, could be utilized .

  • Activity detection: Western blotting with antibodies against the reporter domain or tag can detect the appearance of cleavage products. Alternatively, if using a fluorescent reporter, changes in fluorescence properties upon cleavage can be monitored.

  • Controls: Include:

    • Catalytic site mutants (e.g., mutations in the HEXXH motif)

    • Protease inhibitor treatments

    • Substrate specificity controls with modified cleavage sites

This methodological approach allows for both qualitative assessment (presence/absence of cleavage) and semiquantitative measurement (relative amounts of cleavage products) of htpX1 protease activity.

What post-translational modifications have been observed in M. mazei membrane proteins that might apply to htpX1?

Proteomic analysis of M. mazei has revealed numerous post-translational modifications in membrane and surface proteins that could potentially apply to htpX1 :

Modification TypeDescriptionPotential Relevance to htpX1
O-formylationAddition of a formyl group to serine or threonine residuesMay regulate protease activity or stability
Methyl-esterificationAddition of methyl groups to carboxyl moietiesCould affect substrate recognition or enzyme kinetics
S-cyanylationModification of cysteine residues with CN groupsMight influence the structural integrity of the active site
TrimethylationAddition of three methyl groups to lysine residuesMay impact protein-protein interactions or localization
GlycosylationAddition of carbohydrate structuresCould affect membrane integration or stability

Interestingly, LC-MS/MS analyses of concanavalin A eluate from M. mazei cell lysates identified 154 proteins with various modifications, particularly near catalytic sites of methanogenesis enzymes . While htpX1 was not specifically mentioned among the identified proteins in the cited study, the presence of these modifications in other membrane proteins suggests potential similar modifications in htpX1 that could regulate its function, stability, or interactions within the membrane environment.

How does M. mazei htpX1 compare structurally and functionally to E. coli HtpX?

While both belong to the M48 family of zinc metalloproteinases, M. mazei htpX1 and E. coli HtpX show important similarities and differences:

The E. coli HtpX has been more extensively characterized, with established model substrates and activity assays . These methodological approaches provide a valuable framework for investigating M. mazei htpX1 function. The conservation of key structural features suggests potential functional similarities, though the archaeal cellular context of M. mazei may impose unique requirements or constraints on htpX1 activity.

What insights can be gained from studying htpX1 in the context of archaeal membrane biology?

Studying htpX1 in M. mazei offers unique insights into archaeal membrane biology:

  • Evolutionary perspectives: Archaea possess distinct membrane compositions compared to bacteria, with ether-linked lipids instead of ester-linked lipids. Understanding how htpX1 functions in this environment can illuminate evolutionary adaptations of membrane proteases.

  • Extremophile adaptations: As a methanogen, M. mazei thrives in anaerobic environments. HtpX1 may have adapted specific features for functioning under these conditions, potentially revealing novel mechanisms of protease activity regulation.

  • Protein quality control networks: Proteomic analyses of M. mazei have identified numerous membrane-associated complexes, including components of protein translocation machinery . HtpX1 likely operates within this network, providing insights into archaeal-specific protein quality control mechanisms.

  • Post-translational modifications: The rich landscape of post-translational modifications observed in M. mazei membrane proteins suggests that studying htpX1 could reveal unique regulatory mechanisms involving modifications not commonly observed in bacterial homologs.

  • Methanogenesis-specific adaptations: As a key metabolic process in M. mazei, methanogenesis relies on numerous membrane-bound enzyme complexes. HtpX1 may play a role in maintaining the integrity of these complexes, potentially revealing connections between protein quality control and methanogenic metabolism.

How can I establish an inducible expression system for htpX1 in M. mazei?

Establishing an inducible expression system for htpX1 in M. mazei can be achieved by adapting the system described for other M. mazei proteins :

  • Promoter selection: The p1687 promoter, which directs transcription of methyl transferases involved in methylamine demethylation, provides an excellent inducible system. This promoter is inactive during growth on methanol but rapidly activated when trimethylamine is added to the medium .

  • Vector construction:

    • Clone the p1687 promoter into a suitable plasmid like pWM321

    • Insert the htpX1 gene downstream of the promoter

    • Add appropriate affinity tags (e.g., Strep-tag) for purification and detection

    • Include necessary elements for replication and selection in M. mazei

  • Transformation protocol:

    • Use established transformation methods for M. mazei

    • Select transformants using appropriate antibiotics (puromycin or neomycin)

    • Verify successful transformation by PCR or Western blot

  • Expression conditions:

    • Grow cultures on methanol as the sole carbon source

    • Induce expression by adding trimethylamine to the medium

    • Monitor protein production using Western blot analysis

  • Protein purification:

    • Harvest cells during optimal expression phase

    • Extract membrane fractions containing htpX1

    • Solubilize membrane proteins using appropriate detergents

    • Purify using affinity chromatography based on the incorporated tag

This approach allows for controlled expression of htpX1, facilitating studies of its function and activity under various conditions without the confounding effects of constitutive expression.

What strategies can be employed to identify physiological substrates of htpX1 in M. mazei?

Identifying physiological substrates of htpX1 in M. mazei requires a multi-faceted approach:

  • Comparative proteomics:

    • Generate htpX1 knockout/knockdown strains

    • Compare membrane proteome profiles between wild-type and mutant strains using LC-MS/MS

    • Identify proteins that accumulate in the absence of htpX1 as potential substrates

    • Focus on proteins with post-translational modifications known to occur in M. mazei

  • Co-immunoprecipitation studies:

    • Express tagged catalytically inactive htpX1 (mutation in the HEXXH motif)

    • This "substrate-trapping" mutant will bind but not cleave substrates

    • Isolate protein complexes by immunoprecipitation

    • Identify interacting proteins by mass spectrometry

  • In vitro degradation assays:

    • Purify recombinant htpX1

    • Incubate with isolated M. mazei membrane fractions

    • Analyze degradation products by mass spectrometry

    • Confirm specific degradation through control experiments with protease inhibitors

  • Synthetic peptide libraries:

    • Design fluorogenic peptide libraries based on M. mazei membrane protein sequences

    • Screen for cleavage by purified htpX1

    • Identify sequence motifs preferentially cleaved by the protease

  • In vivo reporter systems:

    • Adapt the model substrate approach developed for E. coli HtpX

    • Create fusion proteins with potential substrate sequences from M. mazei membrane proteins

    • Monitor cleavage patterns in vivo

This comprehensive approach can reveal both the spectrum of potential substrates and the sequence determinants that define htpX1 substrate specificity in the context of M. mazei cellular physiology.

How can I investigate the role of htpX1 in stress response pathways in M. mazei?

Investigating the role of htpX1 in stress response pathways requires systematic analysis of its expression, activity, and functional impact under various stress conditions:

  • Expression analysis:

    • Expose M. mazei cultures to different stressors (heat shock, oxidative stress, pH stress, osmotic stress)

    • Measure htpX1 mRNA levels using qRT-PCR

    • Quantify protein levels by Western blotting with htpX1-specific antibodies

    • Identify conditions that induce htpX1 expression

  • Genetic perturbation studies:

    • Create htpX1 knockout or overexpression strains

    • Compare growth characteristics under stress conditions

    • Measure survival rates following acute stress exposure

    • Assess membrane integrity using appropriate dyes/indicators

  • Protein homeostasis assessment:

    • Monitor accumulation of misfolded membrane proteins under stress

    • Compare proteolytic processing patterns in wild-type vs. htpX1 mutant strains

    • Assess membrane protein turnover rates using pulse-chase experiments

  • Pathway integration analysis:

    • Perform RNA-seq analysis comparing wild-type and htpX1 mutant responses to stress

    • Identify stress response pathways affected by htpX1 loss

    • Validate key interactions through targeted genetic experiments

    • Construct regulatory networks incorporating htpX1 function

  • Physiological impact studies:

    • Measure methanogenesis efficiency under stress in wild-type vs. htpX1 mutant strains

    • Assess membrane potential and proton gradients

    • Evaluate energy metabolism parameters

    • Connect molecular functions to cellular physiology

This methodological framework enables comprehensive characterization of htpX1's role in stress response pathways, providing insights into how this protease contributes to M. mazei adaptation and survival under adverse conditions.

What are the main challenges in working with recombinant membrane proteases like htpX1?

Working with recombinant membrane proteases like htpX1 presents several technical challenges:

ChallengeDescriptionPotential Solutions
Heterologous expressionMembrane proteins from archaea often express poorly in bacterial systemsUse archaeal expression hosts; optimize codon usage; use fusion partners to enhance solubility; employ specialized E. coli strains for membrane protein production
Protein solubilizationExtracting membrane proteins while maintaining their native structure and activityScreen multiple detergents for optimal solubilization; use mild extraction conditions; consider native nanodiscs or amphipols to maintain native environment
Maintaining proteolytic activityActivity can be lost during purification or storageInclude zinc or other cofactors in buffers; validate activity with sensitive assays; optimize storage conditions to preserve functional state
Substrate identificationNatural substrates often unknown or difficult to identifyUse substrate-trapping mutants; employ proteomics approaches; develop model substrates based on known homolog preferences
Assay developmentDeveloping reliable, quantitative assays for proteolytic activityAdapt fluorogenic substrates; use FRET-based assays; establish reporter systems with quantifiable outputs

Research on E. coli HtpX has successfully addressed some of these challenges through the development of model substrates and in vivo activity assays . These approaches can be adapted for M. mazei htpX1, with appropriate modifications to account for archaeal cellular environments.

How can I troubleshoot low activity or expression of recombinant htpX1?

When encountering low activity or expression of recombinant htpX1, consider this systematic troubleshooting approach:

For low expression issues:

  • Host compatibility: M. mazei proteins are often difficult to produce in E. coli . Consider using the inducible expression system developed specifically for M. mazei to produce the protein in its native host.

  • Codon optimization: Analyze the codon usage in the expression vector and optimize it for the host organism.

  • Expression conditions: Optimize temperature, induction time, and inducer concentration. Lower temperatures (16-20°C) often improve membrane protein folding.

  • Fusion partners: Test different fusion tags (MBP, SUMO, etc.) that can enhance solubility and expression.

  • Promoter strength: Test different promoter systems. The p1687 promoter system in M. mazei has been successfully used for controlled protein expression .

For low activity issues:

  • Protein conformation: Ensure proper folding by optimizing solubilization conditions. Test different detergents and buffer compositions.

  • Cofactor requirements: Supplement reactions with zinc or other potential cofactors required for metalloprotease activity.

  • Substrate compatibility: Ensure the substrate used in activity assays is accessible to the active site. Model substrates designed for E. coli HtpX may require modification for htpX1 .

  • Assay conditions: Optimize pH, temperature, and ionic strength based on M. mazei's natural environment (anaerobic, neutral to slightly alkaline pH).

  • Inhibitory compounds: Check for the presence of chelating agents or other inhibitors in buffers that might sequester zinc or otherwise affect activity.

This methodical troubleshooting approach can help identify and address specific factors limiting htpX1 expression or activity.

What considerations are important when designing mutation studies for htpX1?

When designing mutation studies for htpX1, several key considerations should guide your experimental approach:

  • Catalytic site mutations:

    • The HEXXH motif coordinates the catalytic zinc ion and is essential for proteolytic activity

    • Consider conservative mutations (H→N, E→Q) to maintain structural integrity while eliminating catalytic activity

    • These mutations create valuable negative controls and potential substrate-trapping mutants

  • Transmembrane domain modifications:

    • Altering hydrophobic regions may affect membrane integration and topology

    • Consider using membrane topology prediction tools to guide mutation design

    • Validate membrane integration patterns after mutation using protease accessibility assays

  • Substrate binding region mutations:

    • Based on homology to E. coli HtpX, identify regions likely involved in substrate recognition

    • Create systematic alanine scanning mutations to map the substrate-binding interface

    • Correlate changes in substrate specificity with structural features

  • Conservation-guided mutagenesis:

    • Perform multiple sequence alignment of htpX homologs across archaea and bacteria

    • Target highly conserved residues outside the catalytic site to identify functionally important regions

    • Compare effects of equivalent mutations in bacterial and archaeal homologs

  • Validation strategies:

    • Express wild-type and mutant proteins in parallel under identical conditions

    • Verify proper expression and membrane integration before assessing activity differences

    • Use multiple substrates to comprehensively characterize effects on proteolytic function

    • Consider complementation studies in htpX1 deletion strains to assess functional significance

This structured approach to mutation studies can provide valuable insights into htpX1 structure-function relationships, substrate specificity determinants, and evolutionarily conserved mechanisms of membrane protease activity.

What emerging technologies could advance our understanding of htpX1 function?

Several cutting-edge technologies hold promise for deepening our understanding of htpX1 function:

  • Cryo-electron microscopy (cryo-EM):

    • Determination of high-resolution structures of htpX1 in its membrane environment

    • Visualization of substrate binding and conformational changes during catalysis

    • Comparison of archaeal and bacterial HtpX structures to identify unique features

  • Native mass spectrometry:

    • Analysis of htpX1 in its native membrane environment

    • Identification of interaction partners and complexes

    • Characterization of post-translational modifications in the functional protein

  • Single-molecule enzyme kinetics:

    • Real-time monitoring of individual proteolytic events

    • Determination of processivity and substrate preference at the single-molecule level

    • Correlation of structural dynamics with catalytic activity

  • CRISPR-Cas genome editing in methanogens:

    • Precise genetic manipulation of htpX1 in its native context

    • Creation of conditional knockouts to study essential functions

    • Introduction of reporter tags at endogenous loci for live-cell imaging

  • Proteome-wide substrate profiling:

    • Combination of SILAC labeling with proteomic analysis in wild-type versus htpX1 knockout strains

    • Identification of the complete substrate repertoire under various growth conditions

    • Temporal resolution of proteolytic events following stress induction

These technologies, particularly when used in combination, have the potential to revolutionize our understanding of membrane protease function in archaeal systems and elucidate the unique aspects of htpX1 in M. mazei.

How might understanding htpX1 contribute to broader knowledge of archaeal membrane biology?

Research on htpX1 can make significant contributions to our understanding of archaeal membrane biology in several ways:

  • Membrane protein quality control mechanisms:

    • Elucidation of archaeal-specific pathways for removing misfolded or damaged membrane proteins

    • Comparison with bacterial and eukaryotic systems to identify unique features and conserved principles

    • Insights into adaptations for extreme environments where membrane integrity is challenged

  • Archaeal membrane proteome dynamics:

    • Understanding how membrane protein turnover is regulated in archaea

    • Characterization of the interplay between post-translational modifications and proteolytic processing

    • Identification of regulatory mechanisms responding to environmental changes

  • Methanogen-specific adaptations:

    • Insights into how membrane proteases contribute to the maintenance of methanogenesis machinery

    • Understanding of membrane protein homeostasis in anaerobic energy metabolism

    • Potential connections between proteolytic regulation and methane production efficiency

  • Evolutionary perspectives:

    • Comparison of membrane protease functions across domains of life

    • Identification of archaeal innovations in membrane proteostasis

    • Insights into the evolution of membrane-associated quality control mechanisms

  • Bioenergetic implications:

    • Understanding how proteolytic systems contribute to maintaining membrane potential and ion gradients

    • Elucidation of connections between protein quality control and energy conservation in methanogens

    • Potential applications in enhancing or modulating methanogenesis for biotechnological purposes

Detailed characterization of htpX1 function can thus serve as a window into the broader landscape of archaeal membrane biology, potentially revealing novel principles and mechanisms unique to this domain of life.

What interdisciplinary approaches might yield new insights into htpX1 biology?

Interdisciplinary approaches combining diverse scientific fields can generate novel insights into htpX1 biology:

  • Computational biology and structural bioinformatics:

    • Molecular dynamics simulations of htpX1 in archaeal membrane environments

    • Machine learning approaches to predict substrate specificity from primary sequence

    • Evolutionary analysis to trace the functional divergence of HtpX homologs

  • Synthetic biology and protein engineering:

    • Design of modified htpX1 variants with altered specificity or enhanced activity

    • Creation of synthetic regulatory circuits controlling htpX1 expression

    • Development of htpX1-based biosensors for monitoring membrane stress

  • Systems biology and network analysis:

    • Integration of proteomics, transcriptomics, and metabolomics data to position htpX1 in cellular networks

    • Flux balance analysis to predict metabolic consequences of htpX1 perturbation

    • Construction of comprehensive models of membrane protein quality control in methanogens

  • Microbial ecology and environmental microbiology:

    • Investigation of htpX1 function in natural methanogen populations

    • Analysis of htpX1 sequence variation in environmental samples

    • Correlation of htpX1 variants with specific ecological niches

  • Bioprocess engineering and biotechnology:

    • Exploration of htpX1's potential role in optimizing methanogen-based bioprocesses

    • Development of strategies to enhance membrane protein production in archaeal hosts

    • Application of insights from htpX1 to improve stability of industrial membrane proteins

By bridging traditional disciplinary boundaries, these interdisciplinary approaches can address complex questions about htpX1 function that may be inaccessible through conventional methods alone, potentially leading to transformative insights into archaeal membrane biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.