Recombinant Methanosarcina mazei Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Methanosarcina mazei Protein CrcB Homolog 1 (crcB1)

Methanosarcina mazei is a methane-producing archaeon significant in biogenic methane production and environmental research . Proteins in archaea often have unique functions related to their metabolic processes, such as methanogenesis and electron transfer . The term "crcB1" might refer to a specific protein homolog, but without direct references, we'll discuss the broader context of proteins in Methanosarcina mazei and their potential functions.

Overview of Methanosarcina mazei Proteins

Methanosarcina mazei is known for its complex metabolic pathways, including methanogenesis and electron transfer mechanisms . Proteins in this organism are crucial for these processes, often involving membrane-associated functions and interactions with the environment.

Table: Key Features of Methanosarcina mazei Proteins

FeatureDescription
Metabolic RoleInvolved in methanogenesis and electron transfer processes.
Membrane AssociationMany proteins contain transmembrane helices, indicating membrane association .
Environmental AdaptationProteins help the organism adapt to various environmental conditions, such as high organic loads .

Research Findings on Methanosarcina mazei Proteins

Research on Methanosarcina mazei has highlighted the importance of small proteins and dual-function RNAs in its physiology. For instance, Ribo-seq analysis has identified numerous small ORFs encoding proteins with potential regulatory roles .

Table: Ribo-seq Analysis of Small ORFs in Methanosarcina mazei

CategoryNumber of ORFs
Annotated Small ORFs93
Unannotated Small ORFs314
Validated by LC-MS62 annotated, 26 unannotated
Confirmed by Immunoblotting13 unannotated

Potential Functions of Recombinant Proteins

Recombinant proteins derived from Methanosarcina mazei, such as hypothetical crcB1 homologs, could have various applications based on their native functions. These might include roles in electron transfer, membrane transport, or metabolic regulation.

Table: Potential Applications of Recombinant Proteins

ApplicationDescription
Electron TransferEnhancing electron transfer processes in bioelectrochemical systems.
Membrane TransportDeveloping novel transport mechanisms for ions or molecules.
Metabolic EngineeringImproving methanogenesis efficiency or adapting metabolic pathways for biotechnological use.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with blue ice packs by default. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
crcB1; MM_0828; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) (Methanosarcina frisia)
Target Names
crcB1
Target Protein Sequence
MLPAANIGDLFLIGTGGFIGASLRYTISSRMPKIRSIPAGTLTVNFLGSIVLSLLTFSSE PESVVYLVNIGILGSFTTFSTFAYETFKLLEDGQNVSFFLNIFLNVILCLLGVGIAYFAL RL
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and its associated toxicity.
Database Links

KEGG: mma:MM_0828

STRING: 192952.MM_0828

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of CrcB homolog 1 in Methanosarcina mazei?

Methanosarcina mazei is a mesophilic methanogenic archaeal model organism crucial for climate and environmental research due to its methane production capabilities . While specific CrcB homolog 1 functions in M. mazei require further characterization, it likely belongs to the CrcB protein family involved in ion homeostasis and membrane transport processes. The significance of this protein should be considered within the broader context of M. mazei's methanogenesis pathways and energy conservation mechanisms.

Methodological approach: To determine biological significance, researchers should establish Ribo-seq protocols under different growth conditions (such as nitrogen sufficiency and limitation) to analyze translation patterns and expression levels of CrcB homolog 1 . Complementary transcriptomic and proteomic analyses would help correlate expression with specific environmental conditions or metabolic states.

What expression systems are most effective for recombinant production of M. mazei CrcB homolog 1?

Expression system selection should account for the unique characteristics of archaeal proteins:

Expression SystemAdvantagesDisadvantagesApplications
E. coli-basedWell-established protocols, high yieldMay lack archaeal PTMsInitial structural studies
Archaeal hostsNative-like PTMs and foldingLower yields, technical complexityFunctional studies
Cell-free systemsRapid production, toxic protein compatibleLimited PTMsPreliminary characterization

Methodological approach: Epitope tagging strategies, as demonstrated with other M. mazei proteins, can facilitate purification and detection. For CrcB homolog 1, consider C-terminal tags to avoid interfering with potential signal sequences or membrane insertion domains . Validate expression through immunoblotting analysis and optimize conditions based on protein solubility and stability assessments.

How can researchers identify post-translational modifications in CrcB homolog 1?

Research on M. mazei proteins reveals diverse post-translational modifications that may apply to CrcB homolog 1:

Methodological approach: Employ LC-MS/MS analysis of proteolytically-digested samples to identify modifications such as O-formylation, methyl-esterification, and S-cyanylation that have been observed in other M. mazei proteins . Focus analysis on:

  • N-terminal processing events (acetylation has been observed in M. mazei proteins)

  • Detection of mass increments consistent with specific modifications

  • Examination of MS/MS spectra for diagnostic fragment ions indicating modifications

  • Comparison of modified peptides with unmodified counterparts to assess modification frequency

Studies have identified interesting modifications in M. mazei proteins, including S-cyanylation near catalytic sites of methanogenesis enzymes , which might provide insights for CrcB homolog 1 functional domains.

What purification strategies work best for membrane-associated archaeal proteins like CrcB homolog 1?

Purification of membrane-associated proteins from M. mazei presents unique challenges:

Methodological approach: Implement a multi-step purification strategy:

  • Optimize cell lysis conditions using osmotic shock or gentle detergents to preserve protein structure

  • Employ affinity chromatography with epitope-tagged constructs (as used for validating small ORFs in M. mazei)

  • Consider concanavalin A chromatography, which has successfully identified 154 proteins from M. mazei cell lysates, including many membrane-associated proteins

  • Utilize size exclusion chromatography to separate monomeric from oligomeric forms

  • Validate purity and structure using mass spectrometry and structural characterization techniques

For glycosylated proteins, specialized glycopeptide chromatography may reveal important modifications, as observed with M. mazei proteins MM0002, MM0716, MM1364, and MM1976 .

What protocols exist for functional characterization of CrcB homolog 1?

Methodological approach: Implement a systematic functional characterization workflow:

  • Comparative genomics: Analyze conservation across Methanosarcina species to identify functionally important domains

  • Expression profiling: Establish differential expression patterns under varying growth conditions using Ribo-seq and transcriptomics

  • Protein-protein interaction studies: Identify potential interaction partners through pull-down assays or crosslinking experiments

  • Mutational analysis: Create targeted mutations in conserved residues to assess functional impacts

  • Heterologous expression: Test complementation in model systems with known CrcB mutations

These approaches have successfully revealed functional insights for previously uncharacterized small ORFs in M. mazei and can be adapted for CrcB homolog 1 characterization .

How do environmental conditions impact expression and regulation of CrcB homolog 1?

Understanding environmental regulation provides insights into protein function:

Methodological approach: Design experiments to assess CrcB homolog 1 regulation under varying conditions:

  • Comparative transcriptomic and proteomic analysis under different growth conditions

  • Correlation of expression patterns with specific environmental stressors

Previous studies have shown that 29 of 314 unannotated small ORFs in M. mazei are differentially regulated in response to nitrogen availability at the transcriptional level, while 49 show regulation at the translational level . This suggests a complex regulatory network that may also control CrcB homolog 1 expression.

Additionally, consider the potential role of small RNAs in regulation, as many M. mazei sRNAs function as dual-function RNAs, including sRNA 154, which plays a central regulatory role in nitrogen metabolism .

What structural features distinguish CrcB homolog 1 from other membrane transport proteins in M. mazei?

Structural characterization requires specialized approaches for membrane proteins:

Methodological approach: Implement a comprehensive structural analysis pipeline:

  • Computational structure prediction incorporating archaeal-specific parameters

  • Limited proteolysis coupled with mass spectrometry to identify domain boundaries

  • Site-directed spin labeling for topology mapping

  • Cryo-EM or X-ray crystallography for high-resolution structural determination

Pay particular attention to post-translational modifications, as they may impact structural features. Research has shown that M. mazei proteins can undergo various modifications, including those near catalytic sites .

For comparison with other transport proteins, consider structural features from well-characterized membrane proteins in M. mazei, such as components of the tetrahydromethanopterin S-methyl transferase (Mtr) complex and F420H2 dehydrogenase, which have been identified in concanavalin A pull-down studies .

How can researchers resolve contradictory functional data for CrcB homolog 1?

When faced with inconsistent results in archaeal protein characterization:

Methodological approach: Implement a multi-faceted validation strategy:

  • Multi-omics integration: Combine Ribo-seq data with LC-MS analysis to validate translation and expression levels

  • Cross-species complementation: Test functional conservation across archaeal species

  • Targeted validation approaches: Use epitope tagging followed by immunoblotting analysis to confirm expression and localization

  • Domain-specific mutational analysis: Create targeted mutations to isolate specific functions

Research on M. mazei has demonstrated the value of integrated approaches, with epitope tagging validating 13 out of 16 selected unannotated small ORFs that were predicted through Ribo-seq data .

What is the relationship between CrcB homolog 1 and methanogenesis pathways in M. mazei?

Understanding the functional context requires pathway integration:

Methodological approach: Investigate potential connections to methanogenesis through:

  • Co-expression analysis with known methanogenesis proteins

  • Protein-protein interaction studies with key methanogenic enzymes

  • Functional assays under varying methanogenic conditions

  • Localization studies to determine subcellular distribution relative to methanogenic complexes

Consider potential associations with known membrane-bound or membrane-associated complexes identified in M. mazei, including the tetrahydromethanopterin S-methyl transferase (Mtr), F420H2 dehydrogenase (Fpo), and methyl coenzyme M reductase (Mcr) complexes .

Research has identified intriguing modifications near catalytic sites of methanogenesis enzymes , suggesting potential regulatory mechanisms that might also involve CrcB homolog 1 if it participates in these pathways.

How can Ribo-seq and LC-MS protocols be optimized for studying small archaeal proteins like CrcB homolog 1?

Technical optimization is crucial for accurate characterization:

Methodological approach: Adapt established protocols with the following modifications:

TechniqueStandard ParametersOptimized Parameters for Archaeal Proteins
Ribo-seqStandard nuclease treatmentAdjusted nuclease conditions for archaeal ribosomes
Ribo-seqDefault RNA extractionModified extraction for archaeal-specific RNA modifications
LC-MSStandard digestionMultiple proteases to improve coverage
LC-MSRegular gradientExtended gradient for hydrophobic peptides
Database searchStandard parametersModified settings to account for archaeal PTMs

The optimization of these techniques has enabled the identification of 93 previously annotated and 314 unannotated small ORFs coding for proteins ≤70 amino acids in M. mazei , demonstrating the value of tailored approaches for archaeal protein characterization.

What controls are essential when studying recombinant CrcB homolog 1 expression?

Rigorous experimental design requires appropriate controls:

Methodological approach: Implement the following control experiments:

  • Empty vector controls to account for expression system artifacts

  • Non-functional mutant versions (e.g., conserved residue mutations) to validate activity assays

  • Homologs from related archaeal species to assess functional conservation

  • Native purification from M. mazei (if feasible) to compare with recombinant protein

  • Expression under varying conditions to identify regulatory factors

These controls help differentiate genuine functional characteristics from artifacts, particularly important given the complex post-translational landscape observed in M. mazei proteins .

How can researchers distinguish genuine CrcB homolog 1 interactions from non-specific associations?

Establishing specificity in interaction studies:

Methodological approach: Employ stringent validation approaches:

  • Reciprocal pull-down experiments with tagged interaction partners

  • Competition assays with unlabeled proteins

  • Mutational analysis of predicted interaction interfaces

  • In situ proximity labeling to capture interactions in native environments

  • Quantitative interaction measurements using techniques like microscale thermophoresis

Consider that concanavalin A chromatography has identified numerous membrane-associated protein complexes in M. mazei , providing an experimental framework for studying protein-protein interactions involving CrcB homolog 1.

What approaches can resolve challenges in signal peptide prediction for archaeal proteins like CrcB homolog 1?

Signal peptide prediction presents particular challenges in archaeal systems:

Methodological approach: Employ experimental validation of computational predictions:

  • N-terminal sequencing of mature protein to definitively identify processing

  • Comparison of intact protein mass with predicted mass to detect processing events

  • Site-directed mutagenesis of predicted signal peptide cleavage sites

  • Subcellular localization studies with fluorescent protein fusions

Research has shown that algorithms like SignalP 3.0 and Exprot often over-predict the presence of signal peptides in archaeal proteins . Experimental validation revealed that of 31 Methanosarcina protein N-termini recovered, only the S-layer protein MM1976 and its M. acetivorans C2A orthologue, MA0829, underwent signal peptide excision , highlighting the importance of experimental verification.

How should researchers interpret mass spectrometry data for CrcB homolog 1 post-translational modifications?

Accurate interpretation requires systematic analysis approaches:

Methodological approach: Implement a structured analysis workflow:

  • Search for predicted modifications based on patterns observed in other M. mazei proteins

  • Validate modifications through examination of fragment ion series in MS/MS spectra

  • Distinguish biological modifications from sample preparation artifacts

  • Quantify modification stoichiometry when possible

  • Map modifications to functional domains to assess potential impact

Studies of M. mazei proteins have identified various post-translational modifications including O-formylation, methyl-esterification, S-cyanylation, and methylation of histidine residues . These findings provide a framework for analyzing potential modifications in CrcB homolog 1.

What computational approaches best predict CrcB homolog 1 structure and function?

Integrating computational predictions with experimental data:

Methodological approach: Implement a hierarchical prediction strategy:

  • Sequence-based predictions: Transmembrane topology, secondary structure, and conserved domains

  • Homology modeling based on structurally characterized CrcB family members

  • Ab initio modeling for unique regions without structural templates

  • Molecular dynamics simulations to assess stability and conformational changes

  • Integration with experimental constraints from limited proteolysis or crosslinking

For validation, consider the experimental approaches used to characterize other M. mazei membrane proteins, including those identified in concanavalin A pull-down studies .

How might CrcB homolog 1 contribute to M. mazei adaptation to environmental stressors?

Exploring environmental adaptation mechanisms:

Methodological approach: Design experiments to test stress response functions:

  • Expression profiling under various stress conditions (temperature, pH, salinity)

  • Phenotypic analysis of CrcB homolog 1 overexpression or knockout strains

  • Comparative analysis across Methanosarcina species from different environments

Previous studies have shown complex regulatory networks in M. mazei, with many small ORFs differentially regulated in response to environmental conditions . Similar analyses focused on CrcB homolog 1 could reveal its role in stress adaptation.

What emerging technologies could advance understanding of CrcB homolog 1 function?

Exploring cutting-edge methodological approaches:

  • Cryo-electron tomography for in situ structural characterization

  • Single-molecule techniques to assess dynamic properties

  • CRISPR-based genome editing in archaeal systems for precise functional studies

  • Native mass spectrometry for intact complex analysis

  • Integrative structural biology combining multiple data types

These approaches could help overcome current limitations in studying membrane proteins from archaeal systems and provide new insights into CrcB homolog 1 structure and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.