Recombinant Methanosarcina mazei Tetrahydromethanopterin S-methyltransferase subunit B (mtrB)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Recombinant mtrB is a recombinant protein derived from the mtrB gene (locus MM_1544) of Methanosarcina mazei, a methanogenic archaeon. Key attributes include:

  • EC Number: 2.1.1.86 (N5-methyltetrahydromethanopterin–coenzyme M methyltransferase subunit B) .

  • Function: Catalyzes methyl transfer from methylated tetrahydromethanopterin (H₄MPT) to coenzyme M (HS-CoM), a key step in methanogenesis .

  • Recombinant Production: Expressed in E. coli or baculovirus systems, often with N-terminal His-tags for purification .

  • Sequence: Partial (2–108 amino acids) or full-length forms are available; the mature protein includes transmembrane domains .

Biochemical Role in Methanogenesis

mtrB operates within the MtrABCDEFGH complex, a membrane-bound enzyme coupling Na⁺ transport to methyl transfer .

  • Substrate Specificity:

    • Methyl donors: N5-methyl-H₄MPT (derived from methanol, methylamines, or methyl sulfides) .

    • Cofactor: Binds vitamin B₁₂ (cobamide) for methyl transfer .

  • Energy Coupling:

    • Na⁺ Transport: Drives methyl transfer via conformational changes in the MtrCDE subunits .

    • Redox Regulation: Cobamide’s His-on/His-off states modulate Na⁺ flux and enzymatic activity .

Research Applications

mtrB is utilized in:

  • Functional Assays: Studying methyl transfer kinetics and Na⁺ coupling .

  • ELISA: Quantifying protein levels in methanogenic pathways .

  • Transcriptional Studies: Analyzing operon regulation (e.g., mtrB1-mtt1) during growth on trimethylamine (TMA) .

Regulatory Mechanisms

mtrB expression is tightly regulated:

  • Operon Structure: Part of the mtrB1-mtt1 operon, encoding TMA demethylation enzymes .

  • Transcriptional Control:

    • Msr Proteins: Repress methylamine methyltransferase genes in the absence of substrates .

    • Induction: High mRNA levels during TMA consumption, with excretion of dimethylamine (DMA) and monomethylamine (MMA) .

Comparative Analysis of Recombinant mtrB Products

SourceExpression SystemTagPurityNotes
CBM15 E. coliN-terminal His-tag>95%Full-length, optimized buffer
Cusabio E. coliN-terminal His-tag>95%Includes glycerol stabilizer
Cusabio BaculovirusUndisclosed>85%Partial sequence, lower yield

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development with the specified tag.
Synonyms
mtrB; MM_1544; Tetrahydromethanopterin S-methyltransferase subunit B; N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-108
Protein Length
Full Length of Mature Protein
Species
Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) (Methanosarcina frisia)
Target Names
mtrB
Target Protein Sequence
SIVRIAPEINLVMDTESGTVTQERKDSIQYSMEPVFERVDKLDAIADDLVNSLSPSKPLL NTWPGRENTSYIAGIYSNSFYGIIVGLAFSGLLALIIYITRLMGGVV
Uniprot No.

Target Background

Function
This protein is a component of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This step is energy-conserving and involves sodium-ion translocation.
Database Links

KEGG: mma:MM_1544

STRING: 192952.MM_1544

Protein Families
MtrB family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Methanosarcina mazei Tetrahydromethanopterin S-methyltransferase subunit B (mtrB) and what is its role in methanogenesis?

Methanosarcina mazei Tetrahydromethanopterin S-methyltransferase subunit B (mtrB) is a component of the multisubunit membrane protein complex MtrABCDEFGH, which catalyzes a key step in the methanogenesis pathway. This enzyme, with EC number 2.1.1.86, facilitates the transfer of methyl groups from N5-methyltetrahydromethanopterin to coenzyme M via a vitamin B12 derivative (cobamide) as a prosthetic group .

The mtrB subunit functions within the central energy-converting complex that couples vectorial Na+ transport with methyl transfer between one-carbon carriers. This represents one of the most universal electrogenic reactions in methane-producing energy metabolism of methanogenic archaea . The MtrABCDEFGH complex is architecturally composed of a central Mtr(ABFG)3 stalk symmetrically flanked by three membrane-spanning MtrCDE globes, with the complex playing a crucial role in the global biogeochemical material cycle .

How is mtrB expressed in different growth conditions in Methanosarcina mazei?

Expression of mtr genes, including mtrB, in Methanosarcina mazei is regulated based on growth substrates. Transcriptional profiling studies have revealed significant differences in mRNA levels of the mtr operon between cells grown on different carbon sources:

Growth Substratemtr Expression PatternNotes
MethanolBaseline expression level (used as control)The methanol-specific methyltransferase operons (mtaBC1, mtaBC2, mtaBC3) show differential regulation
TrimethylamineSignificant changes in expression compared to methanol-grown cellsThe mtb1-mtt1 operon encoding methyltransferases for sequential demethylation of trimethylamine is found in high concentrations

Analysis of product formation in trimethylamine-grown cells at different optical densities showed that large amounts of dimethylamine and monomethylamine were excreted into the medium, with intermediate compounds consumed only in late exponential growth phase. This suggests that M. mazei adapts to changing trimethylamine concentrations and intermediate compound consumption through regulatory networks for optimal substrate utilization .

What are the structural characteristics of recombinant mtrB?

Recombinant Methanosarcina mazei Tetrahydromethanopterin S-methyltransferase subunit B (mtrB) has the following structural characteristics:

  • UniProt Accession Number: P80655

  • Protein Length: Partial (as described in product specifications)

  • Purity: >85% as determined by SDS-PAGE

  • Source: Typically produced in mammalian cell expression systems for recombinant versions

What experimental approaches are used to study recombinant mtrB function in the context of the complete methyltransferase complex?

Several complementary experimental approaches have been employed to study the function of recombinant mtrB within the methyltransferase complex:

  • Cryo-EM Structural Analysis: High-resolution (2.08 Å) cryo-electron microscopy has been used to determine the structure of the Mtr(ABCDEFG)3 complex, providing insights into the architectural arrangement of the subunits and their functional relationships .

  • Alphafold2 Modeling Integration: Researchers have integrated Alphafold2 information to model functionally competent MtrA–MtrH and MtrA–MtrCDE subcomplexes, allowing structural description of the methyl-tetrahydromethanopterin demethylation and coenzyme M methylation half-reactions .

  • Transcriptional Profiling: Genomic expression patterns have been measured using techniques like real-time RT-PCR to analyze the regulation of mtr genes under different growth conditions. These studies have used the gene encoding glyceraldehyde dehydrogenase (gap) as a standard, as it is considered a stable housekeeping gene in M. mazei .

  • Proteomic Analysis: LC-MS/MS datasets of proteolytically-digested fractions from M. mazei cell lysates have been mined to identify post-translational modifications that may affect protein function. These analyses have revealed interesting modifications near catalytic sites of methanogenesis enzymes .

How are recombinant methyltransferase components being used in the development of modified systems with altered functionality?

Recombinant methyltransferase components, similar to the approach with mtrB, are being utilized in various experimental systems to create modified organisms with altered functionality. For instance, the CRISPRi technology has been applied to develop recombinant BGC (rBCG) strains with enhanced properties:

  • Targeted Gene Regulation: CRISPRi has been used to inhibit expression of essential enzyme pairs like MurT-GatD, which are implicated in amidation of peptidoglycan side-chains. This approach has demonstrated that depletion of these enzymes results in:

    • Reduced growth

    • Cell wall defects

    • Increased susceptibility to antibiotics

    • Altered spatial localization of new peptidoglycan

    • Increased NOD-1 expression in macrophages

  • Enhanced Immune Response: Modified recombinant systems have shown improved control of pathogen growth in cell culture experiments and superior prevention of disease in animal models .

This suggests that similar approaches could potentially be applied to methyltransferase components to study their function or create systems with altered methanogenesis capabilities.

What is known about post-translational modifications of methyltransferase proteins in Methanosarcina mazei?

LC-MS/MS analyses of proteolytically-digested concanavalin A pull down fractions from Methanosarcina mazei Gö1 cell lysates have identified 154 proteins, many of which display post-translationally modified forms that appear biologically relevant (not artifacts of sample handling) .

Key findings regarding post-translational modifications include:

  • O-formylated and methyl-esterified segments in numerous proteins

  • S-cyanylation and trimethylation observed near catalytic sites of methanogenesis enzymes

  • N-terminal modifications: Of 31 Methanosarcina protein N-termini recovered, only M. mazei S-layer protein MM1976 and its M. acetivorans homolog showed significant modifications

These modifications may play crucial roles in protein function, stability, or regulation, particularly for enzymes involved in methanogenesis pathways. The presence of modifications near catalytic sites suggests they might directly influence enzymatic activity or substrate interactions.

What protocols are recommended for optimal handling, storage, and reconstitution of recombinant mtrB?

Based on product specifications, the following protocols are recommended for handling, storage, and reconstitution of recombinant mtrB:

Storage Recommendations:

  • Liquid form: 6 months at -20°C/-80°C

  • Lyophilized form: 12 months at -20°C/-80°C

  • Working aliquots: Store at 4°C for up to one week

  • Important: Repeated freezing and thawing is not recommended

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is the default recommended concentration)

  • Aliquot for long-term storage at -20°C/-80°C

The shelf life is affected by multiple factors including storage state, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself. Proper handling and storage are critical for maintaining the protein's functional integrity.

What expression systems are suitable for producing functional recombinant methyltransferase proteins from methanogenic archaea?

Several expression systems have been used for producing recombinant proteins from methanogenic archaea, including methyltransferase components. Based on the research literature, the following systems have shown success:

Mammalian Cell Expression System:

  • According to product specifications, recombinant mtrB is typically produced in mammalian cell expression systems

  • This approach can provide proper folding and potential post-translational modifications that may be important for function

Heterologous Production in E. coli:

  • For related methyltransferase components, individual heterologous production in E. coli has been reported

  • This approach was used for HdrA2, HdrB2, and HdrB2C2 from M. acetivorans that form an HdrA2B2C2 complex with Fdx2− and F420H2-dependent heterodisulfide reductase activity

CRISPRi-Based Recombinant Systems:

  • Gene regulation platforms including CRISPRi have been used to study essential enzymes in related systems

  • These platforms are ideal for studying the effect of essential immunomodulatory enzymes

When selecting an expression system, researchers must consider:

  • Protein folding requirements

  • Post-translational modifications needed for activity

  • Potential toxicity to the host organism

  • Required yield and purity for intended applications

  • Compatibility with downstream purification methods

How can researchers verify the functional activity of recombinant mtrB in vitro?

Verifying the functional activity of recombinant mtrB requires assessing its ability to participate in methyl transfer reactions as part of the complete methyltransferase complex. Based on research with related methyltransferase components, the following methods can be adapted:

Heterodisulfide Reductase Activity Assay:

For related methyltransferase components, both forward and reverse activities have been measured with the following parameters:

Subunit(s)DirectionVmax (μmol/min/mg)Km (mM)
HdrB2C2Reverse0.6 ± 0.11.4 ± 0.2 HSCoM, 1.2 ± 0.2 HSCoB
HdrB2C2 + HdrA2Forward2.2 ± 0.30.05 ± 0.01 CoMS-SCoB
HdrB2C2 + HdrA2Forward with Ferredoxin4.2 ± 0.2Not determined
HdrB2C2 + HdrA2Reverse0.63 ± 0.1Not determined

Note: For forward activity with ferredoxin, 50 μg of ferredoxin was added to the reaction mixture

Methyl Transfer Activity Measurement:

For mtrB specifically, researchers should consider:

  • Coupled Enzyme Assay: Measure the transfer of methyl groups from N5-methyltetrahydromethanopterin to coenzyme M using spectrophotometric detection of cofactor reduction

  • Radioactive Assay: Use 14C-labeled methyl donors to track the transfer of methyl groups

  • Na+ Transport Assay: Since the methyltransferase complex couples methyl transfer to Na+ transport, measurement of Na+ flux using Na+-sensitive fluorescent dyes or electrodes can provide evidence of functional activity

  • Reconstitution Experiments: Assemble the complete methyltransferase complex using purified recombinant subunits and measure the complete reaction

When reporting activity measurements, researchers should clearly specify the reaction conditions, including buffer composition, pH, temperature, and the presence of any additional cofactors or components required for activity.

What are the NIH guidelines and safety considerations for working with recombinant DNA from methanogenic archaea?

When working with recombinant DNA from methanogenic archaea like Methanosarcina mazei, researchers must adhere to NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. Key considerations include:

Scope of the NIH Guidelines:

The guidelines specify biosafety practices and containment principles for:

  • Recombinant nucleic acid molecules

  • Synthetic nucleic acid molecules that can base pair with naturally occurring nucleic acid molecules

  • Cells, organisms, and viruses containing such molecules

Compliance Requirements:

  • All recombinant or synthetic nucleic acid research within the United States or its territories that falls within specified categories must comply

  • Research conducted at or sponsored by institutions receiving NIH support for recombinant or synthetic nucleic acid research must follow these guidelines

  • Research performed abroad that is supported by NIH funds must also comply

Risk Assessment Considerations:

When working with recombinant mtrB or other archaeal proteins, researchers should:

  • Determine the appropriate risk group for the organism

  • Conduct a comprehensive risk assessment considering:

    • Pathogenicity of the source organism

    • Nature of inserted DNA sequences

    • Host range and stability of the vector

    • Nature of the activity to be conducted

Institutional Requirements:

  • Institutional Biosafety Committee (IBC) approval may be required depending on the nature of the research

  • Proper documentation and reporting of experiments as specified in the guidelines

Methanogenic archaea are typically considered Risk Group 1 organisms (low risk), but specific containment measures should be determined based on the nature of the genetic modifications and intended use.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.