Recombinant Methanosarcina mazei Tetrahydromethanopterin S-methyltransferase subunit D (mtrD)

Shipped with Ice Packs
In Stock

Description

Introduction to the Enzyme

Recombinant Methanosarcina mazei Tetrahydromethanopterin S-methyltransferase subunit D (mtrD) is a key enzyme involved in methanogenesis, the biological production of methane. It catalyzes the transfer of methyl groups from tetrahydromethanopterin to coenzyme M, a critical step in the energy metabolism of methanogenic archaea . This recombinant protein is engineered for research applications, enabling studies on methane cycle biochemistry and archaeal metabolism.

Gene Identification

  • Gene Names:

    • Primary: mtrD

    • Synonyms: MM_1546, MM_RS07985 .

  • Host Systems: Produced in E. coli, yeast, baculovirus, or mammalian cells .

Protein Characteristics

  • EC Number: 2.1.1.86 .

  • Function: Catalyzes the reaction:

    N5-methyltetrahydromethanopterin+coenzyme Mtetrahydromethanopterin+methyl-CoM\text{N5-methyltetrahydromethanopterin} + \text{coenzyme M} \rightarrow \text{tetrahydromethanopterin} + \text{methyl-CoM}
  • Purity: ≥85% as confirmed by SDS-PAGE .

Expression Systems

HostExpression EfficiencyApplications
E. coliHigh yieldStructural studies, enzyme assays
Mammalian cellsPost-translational modificationsFunctional studies
Baculovirus/insect cellsHigh solubilityLarge-scale production

Functional Role in Methanogenesis

mtrD is a subunit of the N5-methyltetrahydromethanopterin–coenzyme M methyltransferase (Mtr) complex, essential for methane formation in Methanosarcina species. Key roles include:

  • Methylamine Metabolism: Upregulated during growth on trimethylamine (TMA), facilitating sequential demethylation to methane .

  • Electron Transport: Part of a membrane-associated electron transport chain linked to ferrihydrite reduction in M. mazei .

Transcriptional Regulation

  • Substrate-Specific Expression: mRNA levels of mtrD increase significantly during methylamine utilization compared to methanol-grown cells .

  • Coordination with Other Genes: Operon structures (e.g., mtb1-mtt1) integrate mtrD with corrinoid proteins for substrate demethylation .

Key Studies

  1. Fe(III) Reduction and Methanogenesis Cometabolism

    • mtrD-associated pathways enhance electron flux during ferrihydrite reduction, with vivianite as a major byproduct .

    • Transcriptional upregulation of oxidative branch genes (e.g., frh, fwd) supports methyl oxidation under Fe(III)-reducing conditions .

  2. Genomic Comparisons

    • mtrD homologs are conserved across Methanosarcina species (M. acetivorans, M. barkeri), but synteny varies distally from the replication origin .

  3. Transcriptional Start Site (TSS) Analysis

    • mtrD is flanked by noncoding regions, suggesting potential regulatory elements in nitrogen-limited growth .

Applications and Future Directions

  • Biotechnological Use: Engineered strains of Methanosarcina with modified mtrD could optimize methane production or environmental bioremediation .

  • Structural Studies: Recombinant mtrD aids in crystallography to map catalytic sites and interaction interfaces.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtrD; MM_1546; Tetrahydromethanopterin S-methyltransferase subunit D; N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) (Methanosarcina frisia)
Target Names
mtrD
Target Protein Sequence
MIDAILGNILWMVFIIIGGVLISWGVHFVPVGGAPAAMAQATGVGTGTVQLATGAGLTGL VSAGFMMNVTDNFPLIVASGAVGAMIMIAVTMIVGTWIYVYGVGCVPSSAKVKVDPITKY RQDLYVSQGTEGHGIPTVSFVSGVIGAALGGIGGSLIYYSLIEVGVSVGLERVGVTSAVT GNSLVAVAAIFAIGIFLVNAVIPSYNIGGTIEGFHDPKFKKWPKAVISSVVASILCAIVA VIAIAQLGGI
Uniprot No.

Target Background

Function

This protein is a component of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This step is crucial for energy conservation and sodium-ion translocation.

Database Links

KEGG: mma:MM_1546

STRING: 192952.MM_1546

Protein Families
MtrD family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural position of mtrD within the Mtr complex?

MtrD functions as an integral membrane subunit within the Methanosarcina mazei Mtr complex. Based on cryo-electron microscopy (cryo-EM) studies, the Mtr complex forms a trimeric structure where MtrD, along with MtrC and MtrE, creates membrane-spanning globes that symmetrically flank the central Mtr(ABFG)3 stalk. These MtrCDE globes form distinct structural domains surrounding the central axis of the complex . The complete multisubunit assembly known as Mtr(ABCDEFG)3 has a molecular mass of approximately 430 kDa when purified without the easily lost MtrH subunit.

The structural relationship between subunits is critical for understanding function. MtrD's position within the membrane-spanning portion of the complex places it at the interface of methyl transfer and ion translocation activities. This strategic positioning suggests that MtrD plays a crucial role in coupling the chemical reaction to energy conservation through sodium transport across the membrane .

What biochemical functions does mtrD perform in the methyl transfer process?

MtrD participates in a sophisticated energy-converting process that couples methyl transfer with sodium ion (Na+) transport. As part of the MtrCDE membrane subcomplex, mtrD helps create the transmembrane channel through which Na+ ions are translocated . The methyl transfer reaction proceeds in two distinct half-reactions:

  • First half-reaction: Methyl transfer from CH3-H4MPT (methyl-tetrahydromethanopterin) to cob(I)amide, a vitamin B12 derivative

  • Second half-reaction: Subsequent transfer of the methyl group from methylcobamide to coenzyme M

MtrD contributes to creating the structural environment that allows conformational changes between inward-facing and outward-facing states of the complex. These conformational shifts are essential for coordinating Na+ transport with the methyl transfer reactions. Specifically, MtrD helps form the cytoplasmic cavity where putative coenzyme M and Na+ binding sites have been identified .

How is mtrD conserved across different methanogenic archaea?

MtrD shows significant sequence conservation across methanogenic archaea, reflecting its essential role in the energy metabolism of these organisms. Comparative genomic analyses indicate that the mtr operon, including the mtrD gene, is present in most methanogenic archaea that utilize the hydrogenotrophic or methylotrophic pathways for methanogenesis.

While the core structure and function of mtrD remain conserved, some adaptations are observed in species inhabiting extreme environments. These adaptations may involve amino acid substitutions that maintain protein stability under specific conditions such as high temperatures, extreme pH, or high salt concentrations. For example, thermophilic methanogens like Methanothermobacter species show adaptations in their mtrD sequence that likely contribute to protein thermostability without compromising the fundamental function of the subunit.

What are the optimal conditions for heterologous expression of recombinant mtrD?

Successful heterologous expression of recombinant mtrD requires careful consideration of multiple factors due to its nature as an integral membrane protein from an archaeal source. A systematic experimental design approach should include:

  • Expression system selection: E. coli-based systems with specialized strains (such as C41(DE3) or C43(DE3)) designed for membrane protein expression often yield better results than standard laboratory strains. Alternatively, archaeal expression hosts like Haloferax volcanii may provide a more native-like membrane environment.

  • Vector design considerations:

    • Inclusion of appropriate fusion tags (His6, MBP, or SUMO) to facilitate purification and potentially improve solubility

    • Use of promoters with tunable expression levels to prevent aggregation from overexpression

    • Incorporation of archaeal codon optimization to overcome potential codon bias issues

  • Expression condition optimization matrix:

ParameterVariables to TestMeasurement Method
Temperature18°C, 25°C, 30°C, 37°CWestern blot, activity assay
Induction time4h, 8h, 16h, 24hSDS-PAGE, Western blot
Inducer concentration0.1mM, 0.5mM, 1.0mM IPTGQuantitative Western blot
Media compositionLB, TB, 2xYT, minimal mediaYield quantification
AdditivesGlycerol (5-10%), specific lipids, osmolytesFunctional assay, stability measurement
  • Membrane fraction isolation: Optimizing cell lysis and membrane separation procedures is crucial, as harsh detergent conditions may destabilize the protein. Gentle lysis methods followed by differential centrifugation help preserve native-like membrane environments.

Implementation of a factorial experimental design would allow for efficient identification of optimal expression conditions while minimizing the number of experiments needed. Monitoring both expression level and functional activity is essential, as conditions yielding higher protein quantities may not necessarily produce properly folded, functional protein.

How can topological analysis approaches be applied to resolve contradictions in mtrD structural data?

When contradictions arise between different structural studies of mtrD, topological data analysis (TDA) offers powerful tools to reconcile discrepancies. Contradictions might emerge from different experimental approaches (X-ray crystallography vs. cryo-EM), sample preparation methods, or computational modeling strategies .

The application of TDA to mtrD structural analysis involves:

  • Data representation: Converting structural data into point clouds or distance matrices that capture essential topological features of the protein.

  • Persistent homology calculation: Identifying stable topological features across multiple scales to distinguish between actual structural features and experimental artifacts.

  • Comparative analysis framework:

    • Alignment of topological signatures from different structural models

    • Identification of conserved topological features across datasets

    • Quantification of topological differences using metrics like bottleneck or Wasserstein distances

  • Integration with deep learning approaches: As demonstrated in text analysis domains, combining topological features with deep learning representations can enhance model performance . For structural biology, this means integrating TDA features with conventional structural analysis methods.

This approach is particularly valuable for resolving contradictions related to:

  • Transmembrane domain orientation discrepancies

  • Conformational state disagreements between structures

  • Conflicting interpretations of specific structural elements

By focusing on topologically invariant features that remain consistent despite minor deformations in the data, researchers can identify which aspects of contradictory structures represent fundamental characteristics versus technique-specific artifacts or noise .

What experimental controls are essential when investigating mtrD interactions with other Mtr subunits?

Investigating protein-protein interactions between mtrD and other Mtr subunits requires rigorous experimental controls to ensure reliable and reproducible results. Essential controls include:

  • Negative interaction controls:

    • Non-interacting membrane proteins from the same organism

    • Truncated or mutated versions of mtrD lacking known interaction domains

    • Empty vector controls for pull-down or co-immunoprecipitation experiments

  • Positive interaction controls:

    • Previously validated interacting partners (e.g., MtrC and MtrE)

    • Synthetic constructs with known binding affinities

    • Internal protein domains with established self-association properties

  • Technical validation controls:

    • Verification of protein expression levels prior to interaction studies

    • Assessment of membrane fraction purity

    • Detergent effect controls to distinguish true interactions from detergent-mediated aggregation

  • Cross-validation strategy:

    • Primary interaction method (e.g., co-immunoprecipitation)

    • Secondary confirmation method (e.g., surface plasmon resonance)

    • Structural validation approach (e.g., crosslinking coupled with mass spectrometry)

  • True experimental design:

    • Random assignment of samples to experimental groups

    • Blinding of analysis where possible

    • Inclusion of technical and biological replicates

How can researchers distinguish between functional and structural roles of conserved residues in mtrD?

Distinguishing between structural and functional roles of conserved residues in mtrD requires a multi-faceted analytical approach. Researchers should implement:

  • Comparative sequence analysis:

    • Construction of multiple sequence alignments across diverse methanogenic archaea

    • Calculation of conservation scores using entropy-based methods

    • Identification of co-evolving residue networks using approaches like statistical coupling analysis

  • Structure-informed classification:

    • Mapping conservation scores onto the three-dimensional structure

    • Analysis of conserved residue clusters in relation to known functional sites

    • Examination of secondary structure elements containing highly conserved residues

  • Experimental validation through mutagenesis:

    • Alanine-scanning mutagenesis of conserved residues

    • Introduction of conservative vs. non-conservative substitutions

    • Functional assays measuring both methyl transfer and Na+ transport activities

  • Computational prediction methods:

    • Molecular dynamics simulations to assess structural stability of mutants

    • Quantum mechanical calculations for residues potentially involved in catalysis

    • Protein-ligand docking studies for residues potentially involved in substrate binding

By integrating these approaches, researchers can develop a classification matrix:

Conservation PatternStructural LocationMutation EffectLikely Role
Universal conservationBuried, away from functional sitesCompromised stabilityStructural
Universal conservationNear substrate binding pocketReduced activity, maintained structureFunctional
Clade-specific conservationSurface-exposedMinor effectAdaptation/Regulation
Co-evolving with other subunitsSubunit interfaceDisrupted complex formationAssembly

This systematic approach helps overcome the common research challenge of overinterpreting conservation data alone, which often fails to distinguish between residues conserved for structural integrity versus those directly involved in function.

What statistical approaches best address contradictions in experimental data on mtrD function?

When faced with contradictory experimental results regarding mtrD function, researchers should employ robust statistical frameworks to resolve discrepancies. The following approaches are particularly valuable:

  • Meta-analysis techniques:

    • Fixed-effects vs. random-effects models to integrate results across studies

    • Forest plots to visualize effect sizes and confidence intervals

    • Funnel plots and trim-and-fill methods to assess publication bias

    • Subgroup analysis to identify methodological factors contributing to contradictions

  • Bayesian statistical frameworks:

    • Prior probability distributions based on existing knowledge

    • Posterior probability updates as new evidence emerges

    • Credible intervals for key functional parameters

    • Bayes factors to quantify strength of evidence for competing hypotheses

  • Robust statistical methods:

    • Non-parametric tests when distributional assumptions are violated

    • Bootstrapping to generate confidence intervals with minimal assumptions

    • Permutation tests to assess significance without parametric assumptions

    • Sensitivity analyses to evaluate the impact of outliers or influential data points

  • Multiple hypothesis testing correction:

    • Bonferroni correction for family-wise error rate control

    • Benjamini-Hochberg procedure for false discovery rate control

    • q-value methodology for large-scale testing scenarios

When applying these approaches to contradictory mtrD functional data, researchers should consider:

  • Different experimental conditions across studies (pH, temperature, salt concentration)

  • Methodological variations in protein preparation

  • Differences in activity assay conditions

  • Potential effects of fusion tags or expression systems

By systematically applying appropriate statistical methods, researchers can distinguish between genuine biological variation and methodological artifacts, leading to a more coherent understanding of mtrD function despite seemingly contradictory data .

How can researchers integrate structural data from cryo-EM with functional assays to understand mtrD's role in the Mtr complex?

Integrating structural and functional data provides a comprehensive understanding of mtrD's role within the Mtr complex. A methodological framework for this integration includes:

  • Structure-guided functional hypothesis generation:

    • Identification of potential Na+ binding sites in the MtrCDE cavity based on cryo-EM structures

    • Mapping of putative coenzyme M interaction regions observed in the cytoplasmic pocket

    • Prediction of conformational changes associated with the inward/outward-facing transitions

  • Targeted mutagenesis validation:

    • Site-directed mutagenesis of residues identified in putative functional sites

    • Introduction of cysteine pairs for disulfide crosslinking to test conformational models

    • Creation of chimeric constructs to verify domain-specific functions

  • Complementary biophysical techniques:

    • Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

    • Electron paramagnetic resonance spectroscopy with site-directed spin labeling

    • Single-molecule FRET to monitor conformational changes during substrate binding

  • Computational simulation and modeling:

    • Molecular dynamics simulations to explore conformational transitions

    • Quantum mechanical/molecular mechanical (QM/MM) calculations for methyl transfer reactions

    • Network analysis to identify allosteric communication pathways within the complex

  • Data integration framework:

    • Creation of a unified structural-functional database for the Mtr complex

    • Development of a quantitative model linking structural features to functional parameters

    • Iterative refinement of hypotheses based on new experimental data

This integrated approach has been successfully applied to related methyltransferase systems and can reveal critical insights about mtrD, such as:

  • The precise role of MtrD in forming the Na+ translocation pathway

  • Mechanisms of conformational coupling between methyl transfer and ion transport

  • Structural basis for the recognition and binding of coenzyme M within the MtrCDE cavity

What novel purification strategies minimize activity loss of recombinant mtrD?

Purification of recombinant mtrD presents unique challenges due to its integral membrane nature and complex interactions with other Mtr subunits. Novel purification strategies that preserve activity include:

  • Native nanodisk incorporation:

    • Co-expression with membrane scaffold proteins (MSPs) and specific lipids

    • Direct extraction into nanodisks without conventional detergent solubilization

    • Size-exclusion chromatography to isolate homogeneous nanodisk populations

    • Advantages: Maintains native-like lipid environment, preserves lateral pressure

  • Styrene maleic acid lipid particle (SMALP) approach:

    • Use of SMA copolymers to extract membrane proteins with surrounding lipids

    • Gentle extraction conditions without conventional detergents

    • Purification via affinity chromatography while maintaining the lipid environment

    • Advantages: Preserves annular lipids, maintains functional state, compatible with various downstream analyses

  • Co-purification with functional partners:

    • Tandem affinity purification targeting different Mtr subunits

    • Reconstitution of minimal functional complexes (e.g., MtrCDE subcomplexes)

    • Validation of complex integrity via analytical ultracentrifugation

    • Advantages: Preserves critical protein-protein interactions, maintains functional architecture

  • Detergent screening and optimization:

    • Systematic evaluation of conventional and novel detergents

    • Assessment of protein stability and activity in different detergent conditions

    • Implementation of high-throughput thermostability assays for optimal formulation

    • Advantages: Identifies conditions that balance extraction efficiency with activity preservation

Effectiveness comparison of purification strategies:

StrategyProtein YieldActivity RetentionStructural IntegrityDownstream Applications
Conventional detergentHighLow-MediumVariableLimited
Nanodisk incorporationMediumHighExcellentBroad
SMALP approachMediumHighExcellentSome limitations
Co-purificationMedium-LowVery highExcellentSpecialized

Implementation of these advanced purification strategies has enabled structural studies resulting in high-resolution cryo-EM structures of the Mtr complex, such as the 2.08 Å structure mentioned in the literature . These approaches represent significant methodological advances over conventional detergent-based purification methods that often result in activity loss and destabilization.

How can researchers design experiments to determine the stoichiometry of Na+ ions transported per methyl group transferred?

Determining the precise stoichiometry of Na+ transport coupled to methyl transfer requires carefully designed experiments that simultaneously monitor both processes. A comprehensive experimental design would include:

  • Reconstitution system development:

    • Preparation of proteoliposomes containing purified Mtr complex

    • Establishment of defined internal and external buffer compositions

    • Verification of uniform protein orientation in the membrane

    • Creation of controlled Na+ and substrate gradients

  • Real-time coupled measurements:

    • Simultaneous monitoring of methyl transfer using radiolabeled substrates (14C-methyl-H4MPT or 14C-methyl-coenzyme M)

    • Tracking Na+ movement using Na+-sensitive fluorescent indicators (e.g., SBFI)

    • Implementation of stopped-flow techniques for rapid kinetic measurements

    • Development of continuous assays for both processes

  • Variable substrate/ion ratio experiments:

    • Systematic variation of Na+ concentrations while keeping substrate concentrations constant

    • Measurement of initial rates under different conditions

    • Construction of ratio plots to determine coupling stoichiometry

    • Validation using thermodynamic constraints

  • Control experiments:

    • Uncoupling controls using ionophores (e.g., monensin for Na+)

    • Substrate analog controls that bind but are not transferred

    • Competitive inhibitor experiments to validate coupling mechanism

    • Mutant variants with defects in either methyl transfer or ion translocation

  • Mathematical modeling:

    • Development of kinetic models incorporating both processes

    • Parameter estimation from experimental data

    • Model validation through prediction of system behavior under new conditions

    • Sensitivity analysis to identify critical parameters

This experimental approach allows researchers to determine whether the stoichiometry is fixed (e.g., 1 Na+ per methyl group) or variable under different conditions. The approach has been successfully applied to related energy-converting membrane protein complexes and represents a gold standard for establishing ion-substrate coupling ratios.

What are the best approaches for resolving contradictions between computational models and experimental data for mtrD?

Resolving contradictions between computational predictions and experimental observations for mtrD requires a systematic approach that bridges theoretical and empirical evidence. Effective strategies include:

  • Model refinement based on experimental constraints:

    • Incorporation of distance constraints from crosslinking experiments

    • Refinement using electron density maps from cryo-EM studies

    • Implementation of coevolutionary constraints from sequence analysis

    • Integration of hydrogen-deuterium exchange mass spectrometry data

  • Experimental validation of computational predictions:

    • Design of critical experiments to test specific model-derived hypotheses

    • Site-directed mutagenesis of residues predicted to be functionally important

    • Spectroscopic measurements to validate predicted structural elements

    • Activity assays to confirm predicted functional mechanisms

  • Uncertainty quantification and sensitivity analysis:

    • Systematic exploration of parameter space in computational models

    • Identification of parameters most sensitive to experimental conditions

    • Explicit consideration of confidence intervals for both computational and experimental results

    • Assessment of model robustness to parameter variations

  • Multi-model consensus approach:

    • Development of multiple independent computational models

    • Identification of consistent predictions across different modeling approaches

    • Meta-analysis of contradictory predictions to identify methodological factors

    • Integration of complementary strengths from different modeling techniques

  • Iterative hypothesis refinement:

    • Formulation of specific hypotheses to explain contradictions

    • Design of targeted experiments to distinguish between competing hypotheses

    • Refinement of computational models based on new experimental data

    • Continuous cycle of prediction, testing, and refinement

For mtrD specifically, contradictions often arise in:

  • Predicted transmembrane topology versus experimental accessibility data

  • Computational predictions of Na+ binding sites versus mutational studies

  • Modeled conformational changes versus observed structural states

  • Predicted protein-protein interfaces versus crosslinking results

By applying topological data analysis approaches that focus on invariant features in combination with traditional structural biology methods, researchers can develop more robust models that better reconcile theoretical predictions with experimental observations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.