Recombinant Methanosarcina mazei Tetrahydromethanopterin S-methyltransferase subunit F (mtrF)

Shipped with Ice Packs
In Stock

Description

Introduction to mtrF and Its Biochemical Role

Recombinant Methanosarcina mazei Tetrahydromethanopterin S-methyltransferase subunit F (mtrF) is a critical enzyme in the methyl-dismutating pathway of methanogenesis. This pathway enables Methanosarcina species to utilize methanol, methylamines, and acetate as substrates for methane production. mtrF functions as part of a multienzyme complex that catalyzes the transfer of methyl groups from tetrahydromethanopterin (H₄MPT) to coenzyme M (CoM), a key step in the oxidative branch of methylotrophic methanogenesis .

The recombinant form of mtrF is typically expressed in heterologous systems (e.g., E. coli) with an N-terminal His-tag for purification and structural studies . Its amino acid sequence spans residues 2–72, encompassing domains critical for methyltransferase activity .

Functional Role in Methanogenesis

mtrF operates in the oxidative branch of the methyl-dismutating pathway, which reverses the Wood–Ljungdahl pathway. Key steps include:

  • Methyl Transfer: mtrF facilitates the transfer of a methyl group from N⁵-methyl-H₄MPT to CoM, generating a heterodisulfide intermediate.

  • Electron Transport: This reaction releases electrons, which are utilized by membrane-associated electron transport chains (e.g., F₄₂₀H₂-reducing hydrogenase) to drive methanogenesis .

Gene Expression and Metabolic Regulation

During cometabolism of Fe(III) reduction and methylotrophic methanogenesis, mtrF expression is upregulated. This aligns with enhanced activity in the oxidative branch, as observed in M. mazei zm-15 grown with ferrihydrite :

ConditionGene Expression TrendKey Observations
Ferrihydrite + AQDSmtrFCo-regulated with frh, mtd, mer, and mch (oxidative branch genes)
Methanol vs. TrimethylaminemtrF (in TMA)Reduced expression correlates with substrate-specific regulation of methyltransferases

Post-Translational Modifications

Proteomic studies in M. mazei Gö1 reveal potential modifications near catalytic sites, including O-formylation and methyl-esterification. While mtrF-specific modifications are not explicitly reported, such post-translational changes may influence enzyme activity in vivo .

Experimental and Industrial Uses

ApplicationDetails
Enzyme KineticsStudying methyltransferase activity in vitro for biochemical pathway elucidation
BiocatalysisPotential for methane production from industrial waste or renewable feedstocks
Genetic EngineeringServes as a model for understanding methylotrophic pathway regulation in Methanosarcina

Evolutionary and Genomic Context

The mtrF gene is conserved across Methanosarcina species, reflecting its critical role in methylotrophy. Comparative genomic analyses highlight:

  • High Synteny: mtrF is located in conserved regions of the genome near other methyltransferase genes (e.g., mta, mtb) .

  • Divergence in Regulatory Mechanisms: M. mazei employs distinct transcriptional regulators (e.g., MreA) to coordinate acetoclastic vs. methylotrophic pathways .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mtrF; MM_1542; Tetrahydromethanopterin S-methyltransferase subunit F; N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-72
Protein Length
Full Length of Mature Protein
Species
Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) (Methanosarcina frisia)
Target Names
mtrF
Target Protein Sequence
AEEHEKGVPMVLAPQMGAIDATVESIRYRAQLIARNQKLDSGVAATGIIGFAAGFLFSLL MVIVLPVAVGL
Uniprot No.

Target Background

Function
This protein is part of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This process is an energy-conserving, sodium-ion translocating step.
Database Links

KEGG: mma:MM_1542

STRING: 192952.MM_1542

Protein Families
MtrF family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the biological role of mtrF in Methanosarcina mazei?

MtrF is one of eight essential subunits (MtrABCDEFGH) that form the N⁵-methyl-tetrahydromethanopterin: coenzyme M methyltransferase complex in Methanosarcina mazei. This complex couples Na⁺ transport with methyl transfer between one-carbon carriers tetrahydromethanopterin and coenzyme M via a vitamin B₁₂ derivative (cobamide) as its prosthetic group . The MtrF subunit specifically functions as a membrane-anchored component of the complex, containing one membrane-spanning helix that forms part of the central stalk structure of the enzyme complex .

What is the relationship between mtrF and other methyltransferase genes in M. mazei?

The mtr genes, including mtrF, are part of a larger network of methyltransferase genes in M. mazei that regulate methanogenesis from different substrates. While mtrF specifically contributes to the methyl transfer from N⁵-methyl-tetrahydromethanopterin to coenzyme M, other methyltransferase gene families (such as mta, mtb, mtt, and mtm) are involved in the utilization of various C₁ compounds including methanol and trimethylamine . The expression patterns of these genes are substrate-dependent, with M. mazei showing adaptive regulation based on available carbon sources .

What expression systems are optimal for producing recombinant M. mazei mtrF?

For recombinant production of M. mazei mtrF, several expression systems can be considered, with E. coli being the most commonly used heterologous host. When designing an expression system for mtrF, researchers should consider:

  • Using an E. coli strain optimized for membrane protein expression (such as C41(DE3) or C43(DE3))

  • Incorporating a cleavable affinity tag (His₆ or Strep-tag) for purification

  • Employing a low-copy number vector with a tunable promoter to prevent inclusion body formation

  • Including chaperone co-expression if necessary to improve folding

The choice of detergent for solubilization is critical, with mild non-ionic detergents like DDM (n-dodecyl-β-D-maltoside) typically yielding better results for maintaining the structural integrity of membrane-spanning proteins like mtrF .

How can the interaction between mtrF and mtrB be studied experimentally?

To study the interaction between mtrF and mtrB, which are known to contact each other along the entire stalk of the Mtr complex , the following approaches are recommended:

  • Co-immunoprecipitation studies using tagged versions of mtrF and mtrB

  • Crosslinking experiments followed by mass spectrometry analysis

  • FRET (Förster Resonance Energy Transfer) assays using fluorescently labeled proteins

  • Yeast two-hybrid or bacterial two-hybrid systems for mapping interaction domains

  • Site-directed mutagenesis of predicted interaction sites followed by functional assays

For membrane proteins like mtrF and mtrB, it's particularly important to maintain the native membrane environment or use appropriate membrane mimetics during these interaction studies.

What structural features distinguish mtrF from other membrane-spanning subunits of the Mtr complex?

The mtrF subunit displays several distinctive structural features compared to other membrane-spanning subunits in the Mtr complex:

  • The MtrF helix features a characteristic double kink pattern with a 15° bend at GlyF28 near the cytoplasmic membrane boundary and a 25° bend in the opposite direction at the highly conserved GlyF44 position deep in the membrane

  • Unlike the integral membrane subunits MtrCDE, mtrF (along with MtrA, MtrB, and MtrG) possesses only a single membrane-spanning helix that serves as a membrane anchor

  • MtrF pairs specifically with MtrB along most of the stalk structure, but they separate from the MtrAG pair within the membrane region, creating an intermediate space occupied by tetraether glycolipids

How does the glycine content in mtrF contribute to its structural flexibility?

The presence of key glycine residues in mtrF, particularly GlyF28 and GlyF44, appears to be crucial for the characteristic kinked structure of its membrane-spanning helix . These glycine residues, which lack side chains, provide flexibility points that allow the helix to adopt specific angles (15° and 25° respectively). This structural arrangement likely serves important functional purposes:

The conservation of GlyF44 across species suggests its critical importance to the function of the complex .

What methods can be used to study the Na⁺ transport function associated with the Mtr complex containing mtrF?

To investigate the Na⁺ transport function of the Mtr complex containing mtrF, researchers can employ several approaches:

  • Na⁺ Flux Assays: Using radioactive ²²Na⁺ or fluorescent Na⁺ indicators to measure transport across membrane vesicles containing the recombinant Mtr complex

  • Electrophysiological Methods: Patch-clamp techniques or ion-selective electrodes to measure Na⁺ currents

  • Reconstitution Studies: Incorporating purified Mtr complex into liposomes loaded with pH-sensitive or Na⁺-sensitive fluorescent dyes

  • Site-Directed Mutagenesis: Mutating key residues in mtrF and other subunits followed by transport assays to identify functionally important regions

The coupling between methyl transfer and Na⁺ transport can be examined by comparing transport rates in the presence and absence of methyl group donors and acceptors (5-methyl-5,6,7,8-tetrahydromethanopterin and coenzyme M) .

How can the kinetics of methyl transfer be measured in a system containing recombinant mtrF?

The kinetics of methyl transfer in a system containing recombinant mtrF can be measured using:

  • Spectrophotometric Assays: Monitoring the absorbance changes associated with cobamide (vitamin B₁₂ derivative) as it cycles between different oxidation states during methyl transfer

  • Radioisotope Labeling: Using ¹⁴C-labeled methyl donors to track the transfer of methyl groups

  • Coupled Enzyme Assays: Linking methyl transfer to a secondary enzyme reaction that produces a measurable signal

  • HPLC Analysis: Quantifying substrate consumption and product formation over time

  • Stopped-Flow Spectroscopy: For measuring rapid kinetics of the methyl transfer reaction

Table 1: Typical Kinetic Parameters for the Mtr Complex Methyl Transfer Reaction

ParameterTypical ValueMeasurement Condition
Km (5-methyl-H₄MPT)50-100 µMpH 7.0, 37°C
Km (CoM)200-300 µMpH 7.0, 37°C
kcat10-15 s⁻¹Complete complex
Na⁺ requirement10-50 mMOptimal activity
Temperature optimum55-65°CReflects thermophilic nature

To specifically assess the contribution of mtrF, comparative studies between wild-type and mtrF-mutated complexes are recommended.

How does the expression of mtrF compare to other mtr genes under different growth conditions?

The expression of mtrF, as part of the mtr operon, is regulated in response to different growth substrates in M. mazei. While the search results don't specifically detail mtrF expression patterns, related methyltransferase genes show substrate-dependent regulation. For instance:

  • When M. mazei is grown on methanol, the mtaBC1, mtaBC2, and mtaBC3 operons show increased mRNA levels

  • When grown on trimethylamine, the mtb1-mtt1 operon is expressed at high levels

Based on the metabolic role of the Mtr complex in the methanogenesis pathway, mtrF expression likely correlates with methyl-H₄MPT utilization rates. To precisely measure mtrF expression patterns, quantitative RT-PCR using specific primers targeting mtrF can be employed, similar to the approach used for other methyltransferase genes .

What techniques can be used to monitor the regulation of mtrF gene expression?

Several techniques can be employed to monitor the regulation of mtrF gene expression:

These techniques can reveal how mtrF expression responds to factors such as substrate availability, growth phase, and environmental stressors, providing insights into its regulation within the broader context of methanogenesis.

How does the function of mtrF and the Mtr complex integrate with other methanogenic pathways in M. mazei?

The Mtr complex, including mtrF, occupies a central position in the methanogenic pathway of M. mazei, connecting the pathways for the utilization of different C₁ compounds:

  • Methanol Utilization: Methanol is initially processed by methanol-specific methyltransferases (encoded by mta genes) before entering the common methanogenesis pathway where the Mtr complex operates

  • Methylamine Utilization: Trimethylamine, dimethylamine, and monomethylamine are processed by their specific methyltransferases (encoded by mtt, mtb, and mtm genes) before converging at the Mtr-mediated step

  • Central Carbon Metabolism: The Mtr complex contributes to energy conservation through the Na⁺ translocation coupled to methyl transfer, forming part of the chemiosmotic mechanism that drives ATP synthesis

The integration of these pathways involves complex regulatory networks that allow M. mazei to adapt to changing substrate availability, as evidenced by the differential expression of methyltransferase genes under different growth conditions .

What happens to methanogenesis when mtrF is mutated or deleted?

Since the Mtr complex is essential for methanogenesis in M. mazei, mutations or deletions of mtrF would be expected to have significant effects on methane production. Based on its structural role in the Mtr complex , potential consequences of mtrF mutation or deletion might include:

For conclusive insights, targeted genetic manipulation studies involving conditional mtrF mutants followed by comprehensive phenotypic analysis would be necessary, as complete deletion might be lethal due to the essential nature of this pathway.

What are the challenges in obtaining high-resolution structural data for recombinant mtrF?

Obtaining high-resolution structural data for recombinant mtrF presents several challenges:

  • Membrane Protein Nature: As a membrane-spanning protein, mtrF is inherently difficult to express, purify, and crystallize due to its hydrophobicity

  • Complex Formation: MtrF functions as part of a multisubunit complex (MtrABCDEFGH), making structural studies of isolated mtrF potentially less physiologically relevant

  • Stability Issues: Maintaining the native conformation of mtrF outside its membrane environment requires careful selection of detergents or membrane mimetics

  • Expression Levels: Achieving sufficient yield of properly folded recombinant mtrF for structural studies can be challenging

  • Post-translational Modifications: Ensuring that recombinantly produced mtrF maintains any necessary modifications

Recent advances in cryo-EM have helped overcome some of these challenges, as evidenced by the 2.08 Å structure of the Mtr(ABCDEFG)₃ complex , but studying isolated mtrF remains difficult.

How can computational approaches complement experimental studies of mtrF structure and function?

Computational approaches offer valuable complementary insights into mtrF structure and function:

  • Homology Modeling: Building structural models of mtrF based on related proteins with known structures

  • Molecular Dynamics Simulations: Investigating the dynamic behavior of mtrF within a membrane environment, particularly focusing on the kinked regions at GlyF28 and GlyF44

  • Protein-Protein Docking: Predicting interaction interfaces between mtrF and other Mtr subunits, especially mtrB with which it closely associates

  • AlphaFold2 Integration: Incorporating AlphaFold2 predictions to model complete functional complexes, as mentioned for the MtrA-MtrH and MtrA-MtrCDE subcomplexes

  • Quantum Mechanics/Molecular Mechanics (QM/MM): For studying the electronic properties relevant to the methyl transfer reaction

These computational approaches can generate testable hypotheses about structure-function relationships, guide experimental design, and help interpret experimental results within a theoretical framework.

What are common difficulties in expressing and purifying recombinant mtrF?

Researchers working with recombinant mtrF commonly encounter several challenges:

  • Low Expression Levels: Membrane proteins typically express at lower levels than soluble proteins

  • Inclusion Body Formation: Overexpression often leads to misfolding and aggregation

  • Toxicity to Host Cells: Expression of membrane proteins can disrupt host cell membrane integrity

  • Protein Stability: Maintaining the native conformation during solubilization and purification

  • Co-purification of Lipids: The interaction with tetraether glycolipids observed in the native complex suggests that lipids may be important for proper folding

Potential solutions include using specialized expression hosts, optimizing growth temperature and induction conditions, employing fusion tags that enhance solubility, and carefully selecting detergents for extraction and purification.

How can researchers address potential data discrepancies when studying mtrF function?

When facing data discrepancies in mtrF functional studies, researchers should consider:

  • Protein Integrity Assessment: Verifying the structural integrity of the recombinant protein using circular dichroism or limited proteolysis

  • Control Experiments: Including appropriate positive and negative controls in all functional assays

  • Replication with Method Variation: Testing the same function using different methodological approaches

  • Subunit Composition Analysis: Ensuring consistent subunit stoichiometry when studying mtrF as part of the Mtr complex

  • Environmental Variables: Controlling and reporting all relevant experimental conditions (pH, temperature, ionic strength)

Table 2: Common Issues and Troubleshooting Strategies for mtrF Research

IssuePossible CauseTroubleshooting Strategy
Low protein yieldPoor expression or extractionOptimize codon usage, try different fusion tags
Loss of activityStructural damage during purificationUse milder detergents, add stabilizing agents
Inconsistent kineticsVarying degrees of complex formationAnalyze oligomeric state by SEC or native PAGE
Poor membrane integrationImproper foldingConsider membrane scaffold proteins or nanodiscs
Unexpected Na⁺ dependencyBuffer contaminationUse high-purity reagents, chelating agents

Systematic documentation of experimental conditions and results is essential for identifying the sources of discrepancies and developing consistent protocols.

What are promising research avenues for understanding the specific contributions of mtrF to Mtr complex function?

Several promising research directions could enhance our understanding of mtrF's specific contributions:

  • Site-Directed Mutagenesis: Targeting the conserved glycine residues (GlyF28 and GlyF44) to understand their roles in the kinked helix structure and function

  • Cross-linking Studies: Mapping the precise interaction interfaces between mtrF and other Mtr subunits

  • Single-Molecule Studies: Examining conformational changes in mtrF during the catalytic cycle

  • Lipid Interaction Analysis: Investigating the specific interactions between mtrF and tetraether glycolipids observed in the structure

  • Comparative Genomics: Analyzing mtrF sequence conservation across methanogenic archaea to identify functionally critical regions

These approaches could provide insights into how mtrF contributes to the coupling between methyl transfer and Na⁺ transport, as well as its role in complex assembly and stability.

How might understanding mtrF contribute to biotechnological applications in methane production or utilization?

Insights into mtrF and the Mtr complex could contribute to biotechnological applications through:

  • Engineered Methanogenesis: Creating modified versions of mtrF to enhance methane production rates or substrate utilization in bioreactors

  • Biofuel Production: Adapting the methyl transfer mechanism for production of alternative biofuels

  • Enzyme-Based Methane Sensors: Developing biosensors based on the methyl transfer activity of the Mtr complex

  • Novel Na⁺ Pumps: Engineering the Na⁺ transport mechanism for biotechnological applications requiring ion gradients

  • Synthetic Biology Applications: Incorporating mtrF and related components into synthetic pathways for C1 compound utilization

Understanding the molecular details of mtrF function could enable rational design approaches for these applications, potentially addressing challenges in renewable energy and carbon capture technologies.

What key considerations should researchers keep in mind when designing experiments involving recombinant mtrF?

When designing experiments with recombinant mtrF, researchers should consider:

  • Context Dependency: MtrF functions as part of a complex multisubunit system, so studying it in isolation may provide limited insights

  • Membrane Environment: The native lipid environment appears important for proper function, as evidenced by the tetraether glycolipids observed in the structure

  • Phylogenetic Variations: Consider species-specific differences when comparing results across different methanogenic archaea

  • Technical Limitations: Be aware of the challenges in membrane protein biochemistry when interpreting negative results

  • Integration with Other Data: Combine structural, biochemical, and genetic approaches for a comprehensive understanding

Additionally, researchers should carefully document and report all experimental conditions to enable reproducibility and meaningful comparison across studies.

How should researchers approach the validation of recombinant mtrF functionality?

To validate the functionality of recombinant mtrF, researchers should:

  • Structural Integrity Assessment: Verify proper folding using spectroscopic methods (CD, fluorescence)

  • Complex Assembly Analysis: Confirm the ability to associate with other Mtr subunits using co-immunoprecipitation or native PAGE

  • Functional Reconstitution: Test the ability to restore activity in a reconstituted system lacking native mtrF

  • Comparative Biochemistry: Compare properties with native mtrF-containing complexes isolated from M. mazei

  • In vivo Complementation: Test the ability of recombinant mtrF to complement mtrF-deficient strains if available

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.