Recombinant Methanosphaera stadtmanae UPF0290 protein Msp_0385 (Msp_0385)

Shipped with Ice Packs
In Stock

Description

Biological Context in Methanosphaera stadtmanae

Methanosphaera stadtmanae is a methanogenic archaeon inhabiting the human gut, where it contributes to methane production via methanol reduction with hydrogen . Its genome (1.77 Mb) encodes 1,534 protein-coding sequences, including numerous adhesin-like proteins (ALPs) involved in microbial interactions . While Msp_0385 is not explicitly classified as an ALP, its genomic context suggests potential roles in:

  • Cell membrane anchoring: Predicted transmembrane helices align with structural features of ALPs .

  • Hypothetical conserved functions: UPF0290 family proteins are often linked to stress response or substrate binding, though experimental validation is lacking .

Production and Applications

The recombinant Msp_0385 protein is commercially produced for research purposes, primarily for:

  • Antibody generation: Used in ELISA or Western blot assays to study M. stadtmanae biology .

  • Structural studies: Potential use in crystallography or cryo-EM to resolve uncharacterized domains.

  • Functional assays: Hypothesized involvement in methanogenesis pathways or interspecies interactions .

Research Gaps and Future Directions

Despite its availability, Msp_0385 remains understudied:

  1. Functional characterization: No peer-reviewed studies directly investigate its enzymatic or structural roles .

  2. Domain architecture: AI-guided predictions for UPF0290 family proteins are absent in current literature .

  3. Ecological significance: Potential interactions with gut microbiota or host cells are unexplored.

Comparative Genomic Insights

M. stadtmanae’s genome lacks genes for molybdopterin synthesis and carbon monoxide dehydrogenase, limiting its metabolic flexibility . Msp_0385 is one of many conserved hypothetical proteins that may compensate for these gaps, possibly through:

  • Substrate transport: Interaction with methanol or acetate derivatives.

  • Stress adaptation: Roles in pH or oxidative stress resistance.

Technical Notes for Researchers

  • Handling: Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for ≤1 week .

  • Purity: Vendor data indicate >90% purity via SDS-PAGE (details unspecified) .

  • Cross-reactivity: Unverified; confirm specificity when used in immunological assays.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributor.
Note: Our standard shipping includes blue ice packs. If you require dry ice shipping, please inform us in advance as an additional fee will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life depends on multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its inclusion in the development process.
Synonyms
carS; Msp_0385; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Target Names
carS
Target Protein Sequence
MDILTLIFYSIYLMIPAYLANGSALVFGGGTPMDFGHYCWDNRRLIGNGVTWRGTVCGGL FGMVIGGILGLLATYGIGSYFFNITASQITFMSGFVPQGLLVGFLLGFGALIGDAIGSFL KRRLNFERGKPVPLLDQLDFVVVSLLFVSTVVSLSLEMIVIIILVSIFLHLGANMFAYMI NLKDVWY
Uniprot No.

Target Background

Function
This protein catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction represents the third step in the ether-bond formation pathway involved in the biosynthesis of archaeal membrane lipids.
Database Links
Protein Families
CDP-archaeol synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanosphaera stadtmanae and what makes it unique?

Methanosphaera stadtmanae is a methanogenic archaeon that inhabits the human intestinal tract. It possesses the most restricted energy metabolism among all methanogenic archaea, capable of generating methane only through the reduction of methanol with H₂. Unlike other methanogens, M. stadtmanae cannot reduce CO₂ to methane or oxidize methanol to CO₂, and it is dependent on acetate as a carbon source for biosynthesis of cellular components. This unique metabolic restriction is explained by the absence of genes encoding for molybdopterin synthesis and the carbon monoxide dehydrogenase/acetyl-coenzyme A synthase complex in its genome . These genomic features distinguish M. stadtmanae from other methanogens and reflect its adaptation to the human intestinal environment. The organism is also known to induce a pro-inflammatory response in humans, differentiating it from Methanobrevibacter smithii, another common gut methanogen .

What is the UPF0290 protein Msp_0385 and where is it encoded in the genome?

The UPF0290 protein Msp_0385 is a protein of unknown function (as indicated by the UPF designation) encoded by the Msp_0385 gene in the genome of Methanosphaera stadtmanae strain DSM 3091. The protein has a UniProt accession number of Q2NHB7 . Within the 1,767,403 bp genome of M. stadtmanae (which has an average G+C content of 28% and contains 1,534 protein-encoding sequences), Msp_0385 represents one of the proteins with ordered locus names . The exact genomic location of this gene is not specified in the search results, but it is part of the full-length genomic sequence and codes for a 187-amino acid protein . The "UPF0290" classification indicates that while the protein has been identified and sequenced, its specific biological function remains to be fully characterized.

How is recombinant Msp_0385 protein typically stored and handled in laboratory settings?

Recombinant Msp_0385 protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein's stability . For storage, the recommended conditions are -20°C for standard storage, while extended storage should be at -20°C or -80°C to maintain protein integrity and activity . When working with the protein, it is advised to avoid repeated freezing and thawing cycles as this can lead to protein denaturation and loss of functionality. For short-term use, working aliquots can be stored at 4°C for up to one week .

When handling the protein, researchers should follow standard protein handling protocols:

  • Thaw aliquots on ice

  • Use appropriate sterile techniques

  • Work quickly to minimize time at room temperature

  • Use appropriate protective equipment as with any biological material

  • Consider adding protease inhibitors if extended manipulation is required

What expression systems are optimal for producing recombinant Msp_0385?

For optimal expression of recombinant Msp_0385, researchers must consider the archaeal origin of this protein. While the search results don't specifically detail expression systems for Msp_0385, established methodologies for archaeal proteins provide guidance. Escherichia coli remains the most commonly used expression system due to its rapid growth and high yield, but several modifications are necessary for archaeal proteins. BL21(DE3) strains containing the pRARE plasmid can address codon bias issues common when expressing archaeal genes. Alternatively, archaeal expression hosts like Sulfolobus solfataricus or Thermococcus kodakarensis might provide more native-like post-translational modifications.

When expressing Msp_0385, a membrane-associated protein, special considerations include:

  • Using lower induction temperatures (16-20°C) to allow proper folding

  • Incorporating solubility tags (e.g., MBP, SUMO) to enhance protein solubility

  • Optimizing extraction using mild detergents like n-dodecyl-β-D-maltoside (DDM) to maintain native structure

For researchers working with M. stadtmanae proteins, it's crucial to note that this organism has a unique codon usage pattern associated with its low G+C content (28%) , which may necessitate codon optimization of the synthetic gene for efficient expression.

What purification strategies yield the highest purity of recombinant Msp_0385?

Purification of recombinant Msp_0385, a membrane-associated protein, requires specialized strategies to maintain structural integrity while achieving high purity. Though specific purification protocols for Msp_0385 aren't detailed in the search results, established approaches for similar archaeal membrane proteins can be adapted. A multi-step purification process typically yields the best results:

  • Initial Extraction: Gentle solubilization using non-ionic detergents (DDM, LDAO, or OG) at concentrations just above their critical micelle concentration

  • Affinity Chromatography: Utilizing the recombinant tag (determined during production process as noted in the product information )

  • Size Exclusion Chromatography: To separate protein-detergent complexes based on size

  • Ion Exchange Chromatography: If additional purification is required

Purification StepPurposeTypical Conditions
Detergent ExtractionSolubilize membrane protein1% DDM in 50 mM Tris, pH 7.5, 150 mM NaCl
Affinity ChromatographyCapture tagged proteinNi-NTA for His-tagged proteins, elution with 250 mM imidazole
Size ExclusionRemove aggregatesSuperdex 200 in 20 mM Tris, pH 7.5, 150 mM NaCl, 0.05% DDM
Ion ExchangeRemove contaminating proteinsMonoQ column, NaCl gradient

Throughout purification, maintaining detergent concentration above CMC and including glycerol (10-20%) in buffers helps prevent protein aggregation. Quality assessment by SDS-PAGE, Western blotting, and mass spectrometry should be performed between purification steps.

How can researchers verify the structural integrity of purified recombinant Msp_0385?

Verifying the structural integrity of purified recombinant Msp_0385 is crucial for ensuring that experimental results accurately reflect the protein's native properties. Researchers can employ multiple complementary techniques to assess structural integrity:

  • Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure elements (α-helices, β-sheets) and can detect significant conformational changes. Near-UV CD (250-350 nm) can provide information about tertiary structure.

  • Fluorescence Spectroscopy: Intrinsic tryptophan fluorescence can serve as a sensitive probe for tertiary structure integrity. The Msp_0385 sequence contains tryptophan residues that can be monitored for changes in local environment.

  • Size-Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Determines the absolute molecular weight and oligomeric state of the protein-detergent complex.

  • Thermal Shift Assays: Measures protein stability through thermal denaturation profiles, which can be compared between different preparations.

  • Cysteine Accessibility Assays: The presence of cysteine residues in Msp_0385 allows for chemical labeling experiments to assess exposure of specific regions.

  • Limited Proteolysis: Correctly folded proteins typically show resistance to proteolytic digestion compared to misfolded variants.

For membrane proteins like Msp_0385, additional considerations include assessing detergent binding through analytical ultracentrifugation or native mass spectrometry. Functional assays, though dependent on better understanding the protein's role, would provide the most relevant assessment of proper folding.

What are the recommended protocols for studying protein-protein interactions involving Msp_0385?

Studying protein-protein interactions (PPIs) involving Msp_0385 requires methodologies adapted for membrane proteins. While no specific protocols for Msp_0385 PPIs are mentioned in the search results, established approaches for membrane protein interaction studies can be applied:

  • Co-immunoprecipitation (Co-IP): Using antibodies against Msp_0385 or potential interaction partners to pull down protein complexes. This requires:

    • Generation of specific antibodies or use of epitope tags

    • Careful optimization of detergent conditions to preserve interactions

    • Gentle washing steps to maintain weak interactions

  • Crosslinking Mass Spectrometry (XL-MS): Chemical crosslinkers can stabilize transient interactions before MS analysis:

    • Use membrane-permeable crosslinkers (DSS, BS3) for internal interactions

    • Apply isotope-coded crosslinkers for quantitative studies

    • Employ MS/MS fragmentation to identify crosslinked peptides

  • Biolayer Interferometry (BLI) or Surface Plasmon Resonance (SPR):

    • Immobilize purified Msp_0385 on a sensor chip via its tag

    • Flow potential interaction partners over the surface

    • Monitor binding kinetics in real-time

  • Förster Resonance Energy Transfer (FRET):

    • Generate fluorescently labeled Msp_0385 and potential partners

    • Detect proximity-dependent energy transfer in reconstituted systems

  • Yeast-Two-Hybrid Adaptations for Membrane Proteins:

    • Split-ubiquitin membrane yeast two-hybrid system

    • MYTH (Membrane Yeast Two-Hybrid) system

When investigating Msp_0385 interactions, consider its potential role in M. stadtmanae's unique metabolic processes. The protein might interact with components of methanol metabolism pathways, particularly the methanol:coenzyme M methyltransferases encoded by mtaABC genes , or other membrane proteins involved in energy conservation.

How can Msp_0385 be used in studies of methanogenesis mechanisms?

Msp_0385 can serve as a valuable tool in studying the unique methanogenesis mechanisms in Methanosphaera stadtmanae, despite its function being currently uncharacterized. This species exhibits a highly restricted form of methanogenesis, generating methane only through reduction of methanol with H₂, unlike other methanogens that can utilize CO₂ . As a membrane protein, Msp_0385 may play a role in this specialized metabolism.

Experimental approaches utilizing Msp_0385 for methanogenesis studies include:

  • Protein Localization Studies: Using fluorescently tagged recombinant Msp_0385 to determine its subcellular location relative to known methanogenesis machinery.

  • Protein-Protein Interaction Networks: Employing pull-down assays with recombinant Msp_0385 to identify potential interactions with established methanogenesis components, particularly the methanol:coenzyme M methyltransferases encoded by the mtaABC genes found in M. stadtmanae .

  • Comparative Proteomics: Analyzing expression levels of Msp_0385 under varying methanogenesis conditions (different H₂ pressures, methanol concentrations) to establish correlations with methanogenic activity.

  • Gene Knockout/Knockdown Studies: Creating Msp_0385 deletion mutants or employing RNA interference techniques to assess the impact on methanol-dependent methanogenesis.

  • Reconstitution Experiments: Incorporating purified Msp_0385 into liposomes with known methanogenesis components to test for functional enhancement or modulation.

These approaches could reveal whether Msp_0385 participates in the electron bifurcation mechanism proposed for M. stadtmanae, which involves the MvhADG-HdrABC and Ehb complexes creating a coupling between ferredoxin and CoM-S-S-CoB reduction .

What are the potential applications of Msp_0385 in human microbiome research?

Recombinant Msp_0385 presents several valuable applications in human microbiome research, particularly given M. stadtmanae's status as a human intestinal inhabitant with unique properties. The search results indicate that M. stadtmanae can induce a pro-inflammatory response in humans, distinguishing it from Methanobrevibacter smithii, another gut methanogen .

Key applications of Msp_0385 in microbiome research include:

  • Biomarker Development: Antibodies against Msp_0385 could be used to develop detection methods for M. stadtmanae in gut microbiome samples, providing insights into its prevalence across different populations and health conditions.

  • Host-Microbe Interaction Studies: Purified Msp_0385 can be used in cell culture models with intestinal epithelial cells or immune cells to investigate whether this specific protein contributes to the pro-inflammatory properties of M. stadtmanae .

  • Comparative Metagenomic Analysis: Using the Msp_0385 sequence as a query for mining metagenomic datasets from various gut microbiome studies to assess the distribution and genetic diversity of M. stadtmanae across different human populations.

  • Functional Metaproteomic Studies: Incorporating antibodies against Msp_0385 in metaproteomic workflows to assess the expression levels of this protein in situ in gut microbiome samples.

  • Microbiome Engineering: If Msp_0385 proves functionally important, it could become a target for microbiome modulation strategies aimed at influencing methane production in the gut.

These applications gain significance considering the finding that colonization of monogastric and ruminant hosts favors different representatives of the Methanosphaera genus , suggesting host-specific adaptations that might involve membrane proteins like Msp_0385.

How might Msp_0385 contribute to understanding host-microbe interactions in the gut?

Msp_0385, as a membrane protein from Methanosphaera stadtmanae, may play a significant role in mediating interactions between this archaeon and the host gut environment. Although its specific function remains uncharacterized, several experimental approaches can elucidate its potential contribution to host-microbe interactions:

  • Receptor Binding Assays: Purified recombinant Msp_0385 can be tested for binding to various host receptors, particularly pattern recognition receptors (PRRs) of intestinal epithelial cells and immune cells. This would determine if Msp_0385 acts as a microbe-associated molecular pattern (MAMP) that directly interacts with host cells.

  • Immunomodulation Studies: Treating human immune cell lines (e.g., THP-1 derived macrophages, dendritic cells) with purified Msp_0385 to assess cytokine production profiles. This approach could reveal whether Msp_0385 contributes to the pro-inflammatory response documented for M. stadtmanae .

  • Intestinal Barrier Function Assays: Using polarized intestinal epithelial cell monolayers (e.g., Caco-2 cells) to investigate if Msp_0385 affects tight junction integrity, transepithelial electrical resistance (TEER), or epithelial permeability.

  • Comparative Studies Across Methanosphaera Isolates: The search results mention isolates from both human stool and bovine rumen . Comparing Msp_0385 homologs between these isolates could reveal host-specific adaptations in protein structure and function.

  • In vivo Colonization Experiments: Using gnotobiotic mouse models, comparing colonization efficiency of wild-type M. stadtmanae versus strains with modified Msp_0385 expression to assess the protein's role in gut colonization and persistence.

These approaches could help determine whether Msp_0385 contributes to M. stadtmanae's ability to establish itself in the human gut and potentially explain differences in colonization patterns observed between monogastric and ruminant hosts .

What role might Msp_0385 play in pro-inflammatory responses observed with Methanosphaera stadtmanae?

Methanosphaera stadtmanae has been shown to induce a pro-inflammatory response in humans, distinguishing it from Methanobrevibacter smithii, another common gut methanogen . As a membrane protein, Msp_0385 represents a potential mediator of this inflammatory response, though its specific role has not been directly established in the search results.

To investigate the potential role of Msp_0385 in pro-inflammatory responses, researchers could employ several experimental approaches:

  • Immune Cell Stimulation Assays: Exposing human immune cells (monocytes, macrophages, dendritic cells) to purified recombinant Msp_0385 and measuring the production of pro-inflammatory cytokines (IL-6, TNF-α, IL-1β) and activation markers. Comparison with whole-cell M. stadtmanae stimulation would determine if Msp_0385 alone can recapitulate the inflammatory response.

  • Pattern Recognition Receptor (PRR) Binding Studies: Investigating whether Msp_0385 interacts with specific PRRs such as Toll-like receptors (particularly TLR2 and TLR4) using reporter cell lines and binding assays.

  • Knockout/Knockdown Experiments: Generating M. stadtmanae strains with reduced or eliminated Msp_0385 expression to assess whether the pro-inflammatory capacity is diminished.

  • Structure-Function Analysis: Creating truncated or mutated versions of Msp_0385 to identify specific domains or epitopes responsible for immune activation.

  • Comparative Analysis: Comparing the inflammatory potential of Msp_0385 homologs from different Methanosphaera isolates, particularly those from human versus ruminant sources , to identify host-specific adaptations in inflammatory signaling.

A methodological table for investigating inflammatory potential might include:

Experimental ApproachMethodologyReadout
Monocyte StimulationTHP-1 cells exposed to purified Msp_0385Cytokine ELISA, NF-κB activation
PRR BindingHEK-Blue™ cells expressing individual TLRsSEAP reporter activity
Inflammasome ActivationPrimary macrophages + Msp_0385IL-1β secretion, caspase-1 cleavage
Comparative ProteomicsLC-MS/MS of membrane fractionsMsp_0385 expression levels across strains

How should researchers interpret functional assays involving Msp_0385?

  • Establish Appropriate Controls:

    • Include both positive controls (proteins with known functions in M. stadtmanae) and negative controls (unrelated proteins with similar physicochemical properties)

    • Use denatured Msp_0385 to distinguish between specific activity and non-specific effects

    • Compare wild-type Msp_0385 with site-directed mutants targeting conserved residues

  • Consider Contextual Factors:

    • Interpret results within the context of M. stadtmanae's restricted metabolism (methanol + H₂ → methane)

    • Account for the membrane localization suggested by the amino acid sequence

    • Evaluate potential interactions with the four sets of mtaABC genes (encoding methanol:coenzyme M methyltransferases) found in M. stadtmanae

  • Apply Multiple Functional Assays:

    • Enzyme activity assays monitoring various potential substrates

    • Membrane transport studies using liposome reconstitution

    • Binding assays with potential interacting partners

    • Growth complementation studies in knockout models

  • Statistical Analysis Framework:

    • Apply appropriate statistical tests based on data distribution

    • Use multiple biological replicates (n ≥ 3) and technical replicates

    • Consider Bayesian approaches for hypothesis testing when prior knowledge is limited

    • Implement multivariate analysis to identify patterns across multiple parameters

Remember that negative results are informative in functional characterization of uncharacterized proteins. Document all tested functions, even those yielding negative results, to guide future research directions.

What are common pitfalls in analyzing Msp_0385 protein activity data?

  • Confounding by Contaminants:

    • Trace contaminants from the expression system may contribute unintended enzymatic activities

    • Solution: Employ multiple purification steps and verify protein purity by mass spectrometry

    • Validate findings using proteins expressed in different systems

  • Detergent Interference:

    • As a membrane protein, Msp_0385 requires detergents for solubilization, which can interfere with activity assays

    • Solution: Test multiple detergent types and concentrations

    • Include detergent-only controls in all assays

  • Artifact Activities:

    • High protein concentrations may show non-physiological activities through promiscuous interactions

    • Solution: Establish concentration-dependent activity profiles and compare with known Km values for similar enzymes

    • Verify that activity scales linearly with enzyme concentration

  • Misattribution of Phenotypes:

    • In knockout or overexpression studies, pleiotrophic effects can be misattributed to Msp_0385

    • Solution: Use complementation studies and point mutations affecting specific residues

    • Implement inducible expression systems to establish temporal relationships

  • Over-interpretation of Homology:

    • Relying too heavily on distant homologs to infer function

    • Solution: Require experimental verification of predicted functions

    • Consider that UPF0290 family proteins may have divergent functions despite sequence similarity

  • Physiological Context:

    • In vitro conditions may not reflect the unique environment of the human gut where M. stadtmanae resides

    • Solution: Mimic physiological conditions (pH, oxygen tension, salt concentrations)

    • Consider the potential influence of host factors on protein activity

A systematic approach to avoiding these pitfalls includes designing decision trees for data interpretation and implementing standardized validation criteria before assigning functions to Msp_0385.

How can researchers distinguish between specific and non-specific effects when studying Msp_0385?

Distinguishing between specific and non-specific effects is particularly challenging when studying uncharacterized proteins like Msp_0385. A comprehensive methodological approach can help researchers differentiate genuine biological activities from artifacts:

  • Dose-Response Relationships:

    • Specific effects typically show saturable dose-response curves

    • Methodological approach: Test Msp_0385 across a concentration range spanning at least three orders of magnitude

    • Analytical tool: Fit data to binding/activity models (e.g., Hill equation, Michaelis-Menten kinetics)

    • Expected outcome: Specific effects show plateaus and calculable EC50/Km values

  • Competitive Inhibition Studies:

    • Specific interactions can be competitively inhibited

    • Methodological approach: Introduce structurally similar compounds or peptides derived from Msp_0385 sequence

    • Analytical tool: Dixon plots or Lineweaver-Burk analysis

    • Expected outcome: Competitive inhibition patterns for specific interactions

  • Mutational Analysis:

    • Specific functions depend on particular amino acid residues

    • Methodological approach: Create alanine scanning mutants or target conserved residues in the UPF0290 family

    • Analytical tool: Correlation of structural changes with functional alterations

    • Expected outcome: Identification of critical residues for activity

  • Controls with Structurally Similar Proteins:

    • Compare with related proteins lacking the proposed function

    • Methodological approach: Use other membrane proteins from M. stadtmanae or UPF0290 family proteins from other organisms

    • Analytical tool: Comparative activity assays under identical conditions

    • Expected outcome: Activity specific to Msp_0385 but not control proteins

  • Binding Specificity Analysis:

    • Determine binding specificity for potential interacting partners

    • Methodological approach: Surface plasmon resonance with multiple analytes

    • Analytical tool: Kinetic analysis (kon/koff rates)

    • Expected outcome: Distinct kinetic parameters for specific versus non-specific interactions

Data interpretation should integrate all these approaches into a weight-of-evidence framework, where multiple lines of evidence converge to support specific functions while ruling out non-specific effects.

What statistical approaches are most appropriate for Msp_0385-related research data?

When analyzing data from Msp_0385 research, researchers should select statistical approaches that address the specific challenges of working with an uncharacterized protein from a relatively understudied organism. The following methodological framework provides guidance for robust statistical analysis:

  • Experimental Design Considerations:

    • Power analysis: Determine appropriate sample sizes based on expected effect sizes

    • Blocking factors: Control for batch effects in protein preparation

    • Randomization: Implement proper randomization schemes to minimize bias

    • Blinding: Where applicable, implement blinding during data collection and analysis

  • Descriptive Statistics and Data Visualization:

    • Represent data using box plots or violin plots rather than bar graphs to show distribution

    • Report all data points for transparency

    • Include appropriate measures of central tendency (median for non-normal distributions) and dispersion (interquartile range)

  • Inferential Statistics:

    • For comparing conditions:

      • Non-parametric tests (Mann-Whitney U, Kruskal-Wallis) if normality cannot be established

      • ANOVA with post-hoc tests (Tukey's HSD, Dunnett's test) for multiple comparisons

      • Consider false discovery rate correction (Benjamini-Hochberg) for multiple testing scenarios

    • For correlation analyses:

      • Spearman's rank correlation for relationships between variables

      • Principal component analysis for multivariate datasets

  • Specialized Statistical Approaches:

    • Bayesian methods for incorporating prior knowledge about membrane proteins

    • Mixed-effects models to account for repeated measures and nested experimental designs

    • Survival analysis techniques for time-to-event data in functional assays

  • Reproducibility and Validation:

    • Cross-validation approaches to test predictive models

    • Bootstrap resampling to establish confidence intervals

    • Independent validation experiments with different methodologies

Statistical ChallengeRecommended ApproachImplementation
Small sample sizesNon-parametric testsR packages: stats, rcompanion
Multiple comparisonsFDR correctionR function: p.adjust()
Complex experimental designsMixed-effects modelsR package: lme4
Uncertain mechanismsBayesian analysisR packages: brms, rstan
Multivariate relationshipsPCA, clusteringR packages: FactoMineR, cluster

What are emerging research questions about Msp_0385's role in methanogenesis?

The unique metabolic constraints of Methanosphaera stadtmanae open several intriguing research questions regarding Msp_0385's potential role in its specialized methanogenesis pathway. M. stadtmanae can only generate methane through reduction of methanol with H₂ and lacks the ability to reduce CO₂ to methane or oxidize methanol to CO₂ . This restricted metabolism provides context for investigating Msp_0385's function.

Emerging research questions include:

  • Energy Conservation Coupling: Does Msp_0385 participate in the electron bifurcation mechanism proposed for M. stadtmanae, which involves coupling between ferredoxin and CoM-S-S-CoB reduction via the MvhADG-HdrABC and Ehb complexes ? Methodological approach: Co-immunoprecipitation studies combined with activity assays measuring electron transfer rates in reconstituted systems.

  • Methanol Metabolism: Could Msp_0385 interact with any of the four sets of mtaABC genes encoding methanol:coenzyme M methyltransferases identified in M. stadtmanae's genome ? Methodological approach: Proximity labeling techniques (BioID, APEX) using Msp_0385 as bait to identify interaction partners.

  • Membrane Transport Functions: Given its predicted membrane localization, does Msp_0385 facilitate transport of substrates or cofactors essential for methanogenesis? Methodological approach: Liposome reconstitution assays measuring transport of radio-labeled methanogenesis intermediates.

  • Adaptation to Hydrogen Dependency: Does Msp_0385 play a role in sensing or responding to hydrogen availability, given M. stadtmanae's strict hydrogen requirement? Methodological approach: Comparative transcriptomics and proteomics under varying hydrogen concentrations, focusing on Msp_0385 expression patterns.

  • Comparative Function Across Isolates: Do homologs of Msp_0385 in different Methanosphaera isolates (human vs. ruminant ) show functional differences that reflect host-specific metabolic adaptations? Methodological approach: Heterologous expression and functional complementation between isolates.

These questions could be explored through integrative approaches combining structural biology, comparative genomics, and functional biochemistry to elucidate the role of this uncharacterized protein in methanogenesis.

How might Msp_0385 contribute to developing interventions for gut dysbiosis?

Understanding Msp_0385's function could inform novel interventions for gut dysbiosis, particularly given M. stadtmanae's unique properties as a human gut methanogen that induces pro-inflammatory responses . Several research pathways could elucidate Msp_0385's potential as a therapeutic target:

  • Targeted Antimicrobial Development: If Msp_0385 proves essential for M. stadtmanae survival or virulence, it could serve as a specific target for reducing inflammatory methanogens without disrupting beneficial microbiota. Methodological approach: High-throughput screening of compound libraries against purified Msp_0385, followed by validation in M. stadtmanae cultures and gut organoid models.

  • Diagnostic Biomarker Potential: Antibodies against Msp_0385 could enable specific detection of M. stadtmanae in clinical samples, allowing personalized interventions based on its presence. Methodological approach: Development of ELISA or lateral flow assays using anti-Msp_0385 antibodies, validated against metagenomically characterized human samples.

  • Immunomodulatory Applications: If Msp_0385 contributes to M. stadtmanae's pro-inflammatory properties , modified versions could be developed as immunomodulatory agents. Methodological approach: Identification of immunogenic epitopes followed by rational design of peptide derivatives with altered immunostimulatory properties.

  • Prebiotic/Probiotic Design: Understanding Msp_0385's role in metabolism could inform the development of prebiotics that selectively inhibit inflammatory methanogens or probiotics that compete with them. Methodological approach: In vitro competition assays between M. stadtmanae and candidate probiotic strains under various prebiotic conditions.

  • Metabolic Engineering Applications: Knowledge of Msp_0385's function might enable engineering of gut methanogens with modified metabolic properties to reduce inflammation while maintaining beneficial functions. Methodological approach: CRISPR-based genome editing of M. stadtmanae or related species followed by assessment of metabolic and immunological properties.

These approaches require careful validation in physiologically relevant models, progressing from in vitro studies to organoids and eventually to animal models, with particular attention to host-specific differences in Methanosphaera colonization patterns .

What comparative studies across different Methanosphaera species could advance understanding of Msp_0385?

Comparative studies of Msp_0385 homologs across different Methanosphaera species and isolates represent a powerful approach to understanding this protein's function and evolution. The search results indicate that Methanosphaera isolates from different hosts (human, bovine, ovine) show distinct genomic characteristics, with bovine isolates having larger genomes than those from monogastric hosts .

Key comparative approaches include:

  • Phylogenomic Analysis of UPF0290 Proteins:

    • Methodological approach: Construct phylogenetic trees of Msp_0385 homologs from all available Methanosphaera genomes and population genomes

    • Analysis technique: Maximum likelihood phylogeny with selection pressure analysis (dN/dS ratios)

    • Expected insights: Identification of conserved domains under purifying selection (functionally critical) versus variable regions potentially involved in host adaptation

  • Comparative Structural Prediction:

    • Methodological approach: Apply AlphaFold2 or similar tools to predict structures of Msp_0385 homologs from different hosts

    • Analysis technique: Structural alignment and conservation mapping

    • Expected insights: Visualization of structural conservation patterns that may indicate functional regions

  • Heterologous Expression and Functional Complementation:

    • Methodological approach: Express Msp_0385 variants from different hosts in a model Methanosphaera strain with the native gene knocked out

    • Analysis technique: Comparative growth curves, methane production rates, and stress tolerance

    • Expected insights: Functional equivalence or host-specific adaptations

  • Comparative Transcriptomics Under Identical Conditions:

    • Methodological approach: Subject isolates from different hosts to identical growth conditions and compare Msp_0385 expression patterns

    • Analysis technique: RNA-Seq with differential expression analysis

    • Expected insights: Conservation or divergence in regulatory mechanisms

  • Host Interaction Studies:

    • Methodological approach: Compare inflammatory responses induced by Msp_0385 variants from human versus ruminant isolates

    • Analysis technique: Cytokine profiling and transcriptional response in host cells

    • Expected insights: Host-specific adaptations in immune interaction properties

This comparative approach is particularly valuable given the finding that colonization of monogastric and ruminant hosts favors different representatives of the Methanosphaera genus , suggesting potential functional specialization of proteins like Msp_0385 in different host environments.

What technological advances might enhance structural and functional studies of Msp_0385?

Advancing our understanding of Msp_0385 will benefit from emerging technologies that address the unique challenges of studying uncharacterized membrane proteins from relatively understudied organisms like Methanosphaera stadtmanae. Several technological frontiers show particular promise:

  • Cryo-Electron Microscopy Advances:

    • Application to Msp_0385: Single-particle cryo-EM could determine the protein's structure in detergent micelles or nanodiscs

    • Technical considerations: Recent advances in sample preparation and image processing now enable structure determination of membrane proteins <100 kDa

    • Methodological advantage: Preserves native-like lipid interactions that may be crucial for function

  • Integrative Structural Biology Approaches:

    • Application to Msp_0385: Combining data from multiple techniques (NMR, SAXS, XL-MS, cryo-EM)

    • Technical considerations: Computational frameworks like IMP (Integrative Modeling Platform) can merge diverse structural data

    • Methodological advantage: Overcomes limitations of individual techniques for membrane proteins

  • In-Cell NMR Spectroscopy:

    • Application to Msp_0385: Monitor protein-ligand interactions in intact cells

    • Technical considerations: Requires optimization of isotope labeling in archaeal expression systems

    • Methodological advantage: Observes interactions under physiologically relevant conditions

  • Native Mass Spectrometry for Membrane Proteins:

    • Application to Msp_0385: Determines oligomeric state and identifies bound cofactors

    • Technical considerations: Recent advances in ionization techniques preserve non-covalent interactions

    • Methodological advantage: Reveals binding partners without crystallization requirements

  • CRISPR-Based Genome Editing in Methanogens:

    • Application to Msp_0385: Generate precise gene knockouts or tagged variants in M. stadtmanae

    • Technical considerations: Optimization of transformation protocols for this specific organism

    • Methodological advantage: Enables direct functional studies in the native organism

  • Microfluidic Organ-on-Chip Technology:

    • Application to Msp_0385: Study protein function in simulated gut microenvironments

    • Technical considerations: Co-culture of M. stadtmanae with human intestinal epithelial cells

    • Methodological advantage: Recreates host-microbe interactions in controlled system

These technological advances, particularly when used in combination, could overcome the current limitations in studying Msp_0385 and accelerate our understanding of its structure, function, and biological significance in the human gut microbiome.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.