Recombinant Methanosphaerula palustris Putative cobalt transport protein CbiM 1 (cbiM1)

Shipped with Ice Packs
In Stock

Description

Functional Analysis in Cobalt Transport

CbiM1 is integral to the cobalt ECF transporter complex (CbiMNQO), which mediates ATP-dependent cobalt uptake. Key findings from structural and biochemical studies:

MechanismDescriptionSource
Substrate BindingCbiM’s L1 loop acts as a substrate gate, enabling cobalt capture and release
ATPase ActivationCbiM stimulates ATP hydrolysis in CbiQ/O, coupling substrate transport to energy
Conformational ChangesCbiQ undergoes closed/open transitions upon ATP binding, driving transport

These insights derive from cryo-EM structures of the CbiMNQO complex in inward-open and ATP-bound states .

Research Applications

CbiM1 enables diverse experimental approaches:

ApplicationDescriptionSource
ELISA DevelopmentQuantitative detection of CbiM1 in biological samples (50 µg kits available)
Structural StudiesCrystallization for X-ray or cryo-EM analysis of ECF transporter dynamics
Genomic ContextStudy of cobalt transport redundancy in M. palustris genomes

Notably, CbiM1 is part of a broader ECF transporter family in methanogens, including CbiM2 (Mpal_2333) and homologs in Methanocorpusculum labreanum .

Related Proteins and Pathways

CbiM1 interacts with:

ProteinRole in TransportSource
CbiNTransmembrane scaffold component (EcfT homolog)
CbiQ/OATPase subunits (EcfA/A’ homologs) driving conformational changes
CbiM2Paralogous substrate-binding component (Mpal_2333)

These interactions position CbiM1 as a critical component in microbial cobalt metabolism, particularly in methanogens inhabiting low-cobalt environments.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. Should you require dry ice shipment, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
cbiM1; Mpal_1702; Putative cobalt transport protein CbiM 1; Energy-coupling factor transporter probable substrate-capture protein CbiM 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
Target Names
cbiM1
Target Protein Sequence
MHIMEGFLPLQWCLFWFAVSAPFIAYGIYQLNRLVKENRSTLPLLAVCGAFIFVLSSLKM PSVTGSCSHPTGTGLGAIMFGPFITSVLSIIVLVYQALFLAHGGLTTLGANVFSMGICGP LLGYWVYQGGKAINLNSIVNVFLASALADIFTYVITSIQLSLAFPAAAGGYMTSFITFAG IFAVTQVPLAIIEGIFLTLTFKYINQIRPDILIHLGVISPAQSKQILEAYS
Uniprot No.

Target Background

Function
This protein is part of the energy-coupling factor (ECF) transporter complex CbiMNOQ, which is involved in cobalt import.
Database Links
Protein Families
CbiM family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanosphaerula palustris CbiM1 protein and what is its significance in microbial physiology?

Methanosphaerula palustris CbiM1 is a putative cobalt transport protein that functions as a critical component of the Energy-coupling factor (ECF) transport system. Specifically, CbiM1 serves as the substrate-binding component in the group-I cobalt ECF transporter complex CbiMNQO in Methanosphaerula palustris, a hydrogenotrophic methanogen isolated from minerotrophic fen peatlands . The protein consists of 231 amino acids and is classified as an ECF transporter S component .

The physiological significance of CbiM1 lies in its role in cobalt acquisition, which is essential for various metabolic processes in methanogens, particularly because cobalt is a crucial cofactor for enzymes involved in methanogenesis. In Methanosphaerula palustris, which grows optimally at 28-30°C and slightly acidic pH (5.5), efficient cobalt uptake systems are critical for survival in nutrient-limited environments such as peatlands .

How does the CbiMNQO transporter complex structurally organize to facilitate cobalt transport?

The CbiMNQO transporter complex represents a modular organization typical of group-I ECF transporters. The complex consists of multiple subunits that work in concert: CbiM and CbiN function as the substrate-binding components (equivalent to EcfS in group-II transporters), CbiQ serves as the integral membrane scaffold component (equivalent to EcfT), and CbiO functions as the cytoplasmic ATP binding/hydrolysis component (equivalent to EcfA) .

The structural organization reveals an inward-open conformation for the CbiMQO complex, which is critical for understanding the transport mechanism. CbiM contains specific structural elements including the substrate-gating L1 loop that regulates cobalt entry. The quaternary structure enables conformational coupling between the ATP-binding CbiO component and the membrane-embedded CbiM/CbiN components, allowing energy from ATP hydrolysis to drive cobalt transport against its concentration gradient .

What role does the substrate-binding subunit CbiM play in stimulating CbiQO's ATPase activity?

Research on the CbiMNQO transporter complex has revealed that the substrate-binding subunit CbiM plays a critical role in stimulating the basal ATPase activity of the CbiQO components. Through reconstitution experiments with different CbiMNQO subunit combinations and subsequent determination of related ATPase activities, researchers have demonstrated that CbiM is not merely a passive binding site for cobalt, but actively participates in the regulation of ATP hydrolysis .

The molecular mechanism of this stimulation involves conformational changes transmitted from CbiM to the ATP-binding CbiO subunits through the scaffold protein CbiQ. When CbiM binds cobalt, it undergoes structural changes that are propagated through the complex, enhancing the ATP hydrolysis rate of CbiO. This allosteric regulation ensures that ATP hydrolysis is coupled to substrate transport, preventing futile energy consumption in the absence of substrate .

How can researchers effectively design experiments to study the conformational changes in the CbiMNQO transporter?

Designing robust experiments to study conformational changes in the CbiMNQO transporter requires careful consideration of multiple factors. Based on established experimental design principles, researchers should implement the following methodological approach:

What is the proposed working model for the CbiMNQO transport mechanism?

Based on structural and functional analyses, a comprehensive working model has been proposed for the CbiMNQO transporter. This model involves several key steps in the transport cycle:

  • Substrate Binding: Cobalt ions bind to the extracellular-facing substrate-binding site on CbiM, specifically involving the L1 loop which functions as a substrate gate .

  • Conformational Coupling: The binding of cobalt to CbiM initiates conformational changes that are transmitted through CbiN to CbiQ, and ultimately to the ATP-binding CbiO domains .

  • ATP Binding and Hydrolysis: The conformational changes in CbiO domains lead to ATP binding and subsequent hydrolysis, which provides the energy for the major conformational rearrangement of the complex .

  • Toppling Mechanism: Unlike the typical alternating access mechanism seen in many transporters, the CbiMNQO complex undergoes a rotation or "toppling" of both CbiQ and CbiM components. This movement reorients the substrate-binding site from facing the extracellular environment to facing the cytoplasm .

  • Substrate Release: The inward-facing conformation allows the release of cobalt into the cytoplasm, completing the transport cycle .

This model explains how the CbiMNQO complex couples ATP hydrolysis to the uphill transport of cobalt ions and highlights the unique toppling mechanism that distinguishes ECF transporters from other ABC transporter families.

How can site-directed mutagenesis be applied to investigate the substrate-gating function of CbiM's L1 loop?

Site-directed mutagenesis provides a powerful approach to investigate the substrate-gating function of the L1 loop in CbiM. A methodological framework for this investigation would include:

  • Identification of Key Residues:

    • Analyze the CbiM structure to identify conserved amino acids within the L1 loop

    • Select residues likely involved in cobalt coordination or conformational changes based on structural data

    • Prioritize charged and polar residues that might interact with the cobalt ion

  • Mutagenesis Strategy:

    • Design alanine-scanning mutations to assess the contribution of individual residues

    • Create charge-reversal mutations to test electrostatic interactions

    • Develop cysteine substitutions for subsequent accessibility studies and cross-linking experiments

  • Functional Characterization:

    • Assess cobalt binding affinity using isothermal titration calorimetry

    • Measure transport activity in reconstituted proteoliposomes

    • Determine the impact on ATPase activity to assess coupling between substrate binding and ATP hydrolysis

  • Structural Validation:

    • Obtain structures of key mutants to correlate functional changes with structural alterations

    • Use molecular dynamics simulations to predict conformational changes in the L1 loop upon mutation

    • Implement hydrogen-deuterium exchange mass spectrometry to assess dynamic changes in loop flexibility

This comprehensive mutagenesis approach would provide detailed insights into how the L1 loop regulates substrate access and contributes to the transport mechanism of the CbiMNQO complex.

What expression systems are most effective for producing functional recombinant CbiM1 protein?

For successful expression of functional recombinant Methanosphaerula palustris CbiM1 protein, researchers should consider several expression systems, each with specific advantages for membrane protein production:

Expression SystemAdvantagesConsiderationsYield Optimization
E. coli (BL21(DE3))High expression levels, cost-effective, rapid growthMay form inclusion bodies, potential toxicityUse C41/C43 strains derived from BL21(DE3) specialized for membrane proteins
Insect cells (Sf9, Hi5)Better for complex membrane proteins, proper foldingHigher cost, longer expression timeOptimize MOI (multiplicity of infection), harvest time, and temperature
Mammalian cells (HEK293, CHO)Native-like lipid environment, complete PTMsHighest cost, complex protocolsUse inducible expression systems, optimize transfection efficiency
Cell-free systemsAvoids toxicity issues, direct access for detergent additionLower yields, expensiveSupplement with lipids or nanodiscs to stabilize membrane proteins

For the CbiM1 protein specifically, E. coli expression systems with specialized membrane protein vectors (such as pET-based vectors with mild promoters) have shown success. Addition of fusion tags like His6 for purification enables efficient isolation of the target protein . When expressing CbiM1, researchers should supplement growth media with cobalt to ensure proper folding of this metal transport protein.

How can researchers optimize purification protocols for CbiM1 to maintain its native conformation?

Purification of membrane proteins like CbiM1 while maintaining native conformation requires careful optimization at each step:

  • Membrane Extraction:

    • Use mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) for initial solubilization

    • Implement a systematic detergent screening to identify optimal conditions

    • Maintain physiologically relevant pH (5.5-6.0) based on M. palustris optimal growth conditions

  • Affinity Chromatography:

    • Utilize the His-tag present in recombinant constructs for immobilized metal affinity chromatography (IMAC)

    • Include low concentrations of detergent in all buffers to prevent aggregation

    • Add 10-20% glycerol to stabilize the protein during purification

  • Size Exclusion Chromatography:

    • Perform SEC as a final polishing step to ensure homogeneity

    • Monitor protein oligomeric state to confirm proper assembly

    • Include cobalt in buffers if necessary to maintain the substrate-bound conformation

  • Stability Assessment:

    • Use differential scanning fluorimetry to monitor thermal stability

    • Implement light scattering techniques to monitor aggregation propensity

    • Validate functional activity through ATPase assays or cobalt binding studies

The successful purification of CbiM1 should result in a homogeneous preparation suitable for structural and functional studies, with yields typically in the range of 1-5 mg per liter of expression culture.

What are the key considerations for reconstituting CbiMNQO components to study transporter activity?

Reconstitution of the CbiMNQO components into artificial membrane systems requires careful attention to several critical factors:

  • Component Stoichiometry:

    • Maintain the correct molar ratios of CbiM, CbiN, CbiQ, and CbiO components (likely 1:1:1:2 based on structural studies)

    • Verify complex formation using analytical techniques such as size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

    • Consider sequential addition protocols to optimize complex assembly

  • Lipid Composition:

    • Select lipid mixtures that mimic the native membrane environment of M. palustris

    • Test various lipid compositions (e.g., E. coli polar lipids, synthetic phospholipid mixtures)

    • Adjust cholesterol or ergosterol content to modulate membrane fluidity

  • Reconstitution Method:

    • Compare different techniques including detergent removal by dialysis, Bio-Beads, or cyclodextrin

    • Optimize protein-to-lipid ratios to achieve functional incorporation

    • Consider nanodiscs or lipid nanodiscs for single-particle studies

  • Functional Validation:

    • Develop cobalt transport assays using fluorescent indicators or radioisotopes

    • Measure ATP hydrolysis rates to confirm energy coupling

    • Implement stopped-flow spectroscopy to capture rapid conformational changes

Through careful optimization of these parameters, researchers can successfully reconstitute functional CbiMNQO complexes to study the molecular mechanism of cobalt transport in controlled in vitro systems, as demonstrated in previous structural and functional studies of this transporter .

How might cryo-EM techniques advance our understanding of CbiMNQO conformational dynamics?

Cryo-electron microscopy (cryo-EM) offers significant potential for advancing our understanding of CbiMNQO conformational dynamics through several methodological advantages:

The integration of cryo-EM with complementary techniques like molecular dynamics simulations and hydrogen-deuterium exchange mass spectrometry would provide an unprecedented view of the dynamic processes underlying cobalt transport by the CbiMNQO complex.

What comparative insights might be gained by studying CbiM1 homologs across different methanogenic archaea?

Comparative analysis of CbiM1 homologs across diverse methanogenic archaea offers valuable insights into evolutionary adaptations and functional conservation:

  • Sequence-Structure-Function Relationships:

    • Identification of highly conserved residues across diverse methanogens would highlight functionally critical amino acids

    • Variable regions might reflect adaptation to different ecological niches (e.g., acidic peatlands vs. alkaline environments)

    • Correlation of sequence variations with metal specificity could reveal substrate recognition determinants

  • Ecological Adaptations:

    • Comparison of CbiM1 from M. palustris (adapted to slightly acidic pH 5.5) with homologs from alkaliphilic methanogens

    • Analysis of temperature adaptations in psychrophilic, mesophilic, and thermophilic methanogen CbiM proteins

    • Investigation of metal availability adaptations across different environmental niches

  • Transport Kinetics Variations:

    • Systematic comparison of cobalt transport rates and affinity across different methanogen species

    • Correlation of kinetic parameters with environmental metal availability

    • Development of structure-based models to predict transport efficiency from sequence information

  • Evolutionary History:

    • Phylogenetic analysis to trace the evolutionary history of CbiM proteins in relation to methanogen diversification

    • Investigation of potential horizontal gene transfer events in the acquisition of cobalt transport systems

    • Analysis of co-evolution patterns between CbiM and its partner proteins (CbiN, CbiQ, CbiO)

This comparative approach would not only enhance our understanding of CbiM1 in M. palustris but would also provide broader insights into metal homeostasis mechanisms across methanogenic archaea and their ecological significance in various environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.