Recombinant Methanosphaerula palustris Putative cobalt transport protein CbiM 2 (cbiM2)

Shipped with Ice Packs
In Stock

Description

Functional Characterization

cbiM2 functions as the substrate-capture component (S component) of the ECF transporter complex, which couples cobalt uptake to ATP hydrolysis . Key findings:

  • Substrate Specificity: Binds cobalt ions with high affinity, essential for synthesizing vitamin B12 derivatives in methanogens .

  • Mechanism: Works alongside ATP-binding components (CbiO) and scaffold proteins (CbiQ) to transport cobalt across the cell membrane. ATP hydrolysis drives conformational changes in CbiM2, enabling substrate release .

  • Activity: Reconstitution experiments demonstrate ATPase activity stimulation upon cobalt binding, confirming its role in energy coupling .

Biological Context in Methanosphaerula palustris

Methanosphaerula palustris E1-9c thrives in nutrient-poor peatlands, relying on hydrogenotrophic methanogenesis for energy . The genome of E1-9c encodes redundant micronutrient transporters, including three cbiM homologs, suggesting adaptive strategies for cobalt acquisition in oligotrophic environments . Comparative genomics highlights cbiM2’s role in:

  • Methanogenesis: Cobalt is a cofactor for methyltransferase enzymes in the methane synthesis pathway .

  • Environmental Adaptation: Differential expression of transporters like cbiM2 may explain niche specialization in peatlands .

Research Applications

Recombinant cbiM2 is widely used in:

  • Structural Biology: Crystallography and cryo-EM studies to resolve ECF transporter mechanisms .

  • Biochemical Assays: ATPase activity measurements and cobalt-binding kinetics .

  • Microbial Physiology: Investigating trace metal uptake in extremophiles .

Comparative Analysis with Homologs

FeatureM. palustris cbiM2M. labreanum cbiM2
UniProt IDB8GEB7 A2SSE8
Protein Length235 aa (partial) 231 aa (full-length)
Expression HostE. coli E. coli
Key DomainECF transporter S component ECF transporter S component

Future Directions

While structural and functional data for cbiM2 are emerging, unresolved questions include:

  • The role of auxiliary proteins (e.g., CbiN) in transporter assembly .

  • Evolutionary divergence of ECF transporters in archaea vs. bacteria .

  • Engineering cbiM2 for biotechnological applications (e.g., biofuel production) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
cbiM2; Mpal_2333; Putative cobalt transport protein CbiM 2; Energy-coupling factor transporter probable substrate-capture protein CbiM 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-235
Protein Length
full length protein
Species
Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
Target Names
cbiM2
Target Protein Sequence
MHIMEGFLPAGWCLVWWLIALPFLVMGIIQLRRMMKEDREYLPLLGVCGAFIFILSALKL PSVTGSCSHPTGTGLSTICFGYCVTAVVGAIVLLFQALLLAHGGLSTMGANMVSMAIGGP IAGYAVYKLMKDTSINIYVTVFLASAVADIVTYIITSFELALAYPAQVGGFLASFSAFFS IFAITQIPLSIMEGVVLALVFKYIIQLKPEIILKLHVFSEEQIAKARLAGDAEVA
Uniprot No.

Target Background

Function
CbiM2 is part of the energy-coupling factor (ECF) transporter complex CbiMNOQ involved in cobalt import.
Database Links
Protein Families
CbiM family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanosphaerula palustris and what ecological significance does it have?

Methanosphaerula palustris E1-9C T is a hydrogenotrophic methanogen (methane-producing archaeon) isolated from a minerotrophic fen. It belongs to the Methanoregulaceae family within the Methanomicrobiales order . This organism represents the first reported genome in the Methanosphaerula genus, with a complete genome sequence of 2.92 Mb .

M. palustris has significant ecological importance in carbon cycling within peatland ecosystems. Unlike some related methanogens such as Methanoregula boonei 6A8 T that dominate in acidic oligotrophic bogs, M. palustris is predominantly found in minerotrophic fens . This differential distribution pattern suggests specialized adaptations to specific ecological niches, making it an important model organism for studying methanogen ecology and evolution.

What is the function of the cobalt transport protein CbiM 2 (cbiM2) in M. palustris?

The cobalt transport protein CbiM 2 (cbiM2) in M. palustris functions as a substrate-specific integral membrane component of an Energy-coupling factor (ECF) transporter system . This system is specialized for the uptake of cobalt ions (Co²⁺) into the cell, which is essential for various cellular processes.

In ECF transporters, the CbiM component serves as the substrate-binding protein (S-component) that specifically recognizes and binds to cobalt ions . The complete cobalt transport system typically includes additional components: a transmembrane coupling protein (T-component), ATP-binding cassette (ABC) ATPases, and in metal-specific systems like this one, auxiliary components such as CbiN . The coordinated action of these proteins allows for the energy-dependent transport of cobalt across the cell membrane, supporting critical metabolic functions that require this essential trace metal.

How can recombinant CbiM 2 protein be effectively expressed and purified for functional studies?

Methodological approach for expression and purification of recombinant CbiM 2:

  • Expression system selection:

    • For membrane proteins like CbiM 2, specialized expression systems are required. E. coli strains engineered for membrane protein expression (such as C41(DE3) or C43(DE3)) are recommended.

    • Alternative systems like Pichia pastoris may be considered for better folding of archaeal membrane proteins.

  • Vector design considerations:

    • Include an affinity tag (His6, FLAG, or Strep-tag) for purification

    • Consider fusion partners that enhance solubility and expression

    • Use inducible promoters (T7 or tac) for controlled expression

    • Optimize codon usage for the expression host

  • Expression optimization:

    • Culture at lower temperatures (16-25°C) after induction to slow protein production and improve folding

    • Test various induction conditions (inducer concentration, induction time, cell density at induction)

    • Supplement media with additives that stabilize membrane proteins

  • Membrane protein extraction:

    • Use gentle detergents for solubilization (n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or lauryl maltose neopentyl glycol (LMNG))

    • Optimize detergent concentration and solubilization time

    • Consider lipid supplementation during extraction

  • Purification strategy:

    • Initial capture using affinity chromatography based on the chosen tag

    • Size exclusion chromatography for increasing purity and assessing protein homogeneity

    • Ion exchange chromatography as a potential polishing step

  • Protein quality assessment:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Circular dichroism to assess secondary structure integrity

    • Thermal stability assays to evaluate protein stability

This methodological approach should yield functional recombinant CbiM 2 protein suitable for downstream experimental applications while maintaining the protein's native conformation and activity.

What experimental approaches are most effective for studying CbiM-CbiN interactions in cobalt transport systems?

Recommended experimental approaches for studying CbiM-CbiN interactions:

  • Protein-protein interaction analysis:

    • Cysteine-scanning mutagenesis and crosslinking: This technique has proven effective for identifying specific interaction points between CbiM and CbiN . By systematically introducing cysteine residues at predicted interaction sites and performing crosslinking experiments, researchers can map the interaction interface.

    • Co-immunoprecipitation (Co-IP): Using tagged versions of CbiM and CbiN to pull down protein complexes and confirm interactions.

    • Bioluminescence/Förster Resonance Energy Transfer (BRET/FRET): For measuring dynamic interactions in native-like membrane environments.

  • Structural biology approaches:

    • Electron paramagnetic resonance (EPR) with site-directed spin labeling: This approach has successfully demonstrated the ordered structure of the CbiN loop and its interaction with CbiM .

    • Solid-state nuclear magnetic resonance (ssNMR): Particularly useful for membrane proteins, this technique can detect dynamic changes in protein conformation upon interaction, as previously demonstrated with CbiM-CbiN systems .

    • Cryo-electron microscopy: For visualizing the complete transporter complex structure.

  • Functional transport assays:

    • Radioactive ⁵⁷Co²⁺ uptake assays: To quantitatively measure transport activity in reconstituted proteoliposomes containing different combinations of CbiM, CbiN, and variants.

    • Fluorescent metal ion probes: For real-time monitoring of transport kinetics.

    • Growth complementation assays: Using cobalt-dependent growth phenotypes to assess functional transport in vivo.

  • Computational approaches:

    • Molecular dynamics simulations: To model the dynamic interactions between CbiM and CbiN loops.

    • Protein-protein docking: To predict interaction interfaces that can be validated experimentally.

    • Evolutionary coupling analysis: To identify co-evolving residues that may form contacts in the protein complex.

These complementary approaches provide a comprehensive toolkit for elucidating the molecular basis of CbiM-CbiN interactions, which are critical for cobalt transport activity.

How can researchers effectively reconstitute functional CbiM 2 protein into proteoliposomes for transport studies?

Protocol for functional reconstitution of CbiM 2 into proteoliposomes:

  • Materials preparation:

    • Purified recombinant CbiM 2 protein in detergent solution

    • Synthetic lipids (recommended mixture: POPC:POPE:POPG at 7:2:1 ratio)

    • Reconstitution buffer (typically 50 mM HEPES, 150 mM KCl, pH 7.4)

    • Bio-Beads SM-2 or equivalent detergent adsorbent

    • Calibrated cobalt indicator (e.g., fluorescent chelator) for transport assays

  • Liposome preparation:

    • Dissolve lipids in chloroform, dry under nitrogen stream

    • Remove residual solvent under vacuum for 3 hours

    • Hydrate lipid film with reconstitution buffer to 10 mg/ml

    • Subject to freeze-thaw cycles (5×) using liquid nitrogen and 37°C water bath

    • Extrude through 400 nm polycarbonate membrane to form unilamellar vesicles

  • Protein reconstitution:

    • Solubilize preformed liposomes with mild detergent (e.g., 0.5% Triton X-100)

    • Add purified CbiM 2 at a protein-to-lipid ratio of 1:100 to 1:200 (w/w)

    • For functional studies, include auxiliary protein CbiN (critical for activity)

    • Incubate the mixture at 4°C for 30 minutes with gentle agitation

  • Detergent removal:

    • Add Bio-Beads SM-2 (80 mg/ml) in three sequential additions:

      • First addition: incubate 2 hours at room temperature

      • Second addition: incubate overnight at 4°C

      • Third addition: incubate 2 hours at room temperature

    • Remove Bio-Beads by gentle aspiration

  • Proteoliposome purification:

    • Collect proteoliposomes by ultracentrifugation (150,000 × g, 1 hour, 4°C)

    • Resuspend pellet in fresh reconstitution buffer

    • Determine protein incorporation by SDS-PAGE analysis of an aliquot

  • Functional validation:

    • Load proteoliposomes with cobalt-sensitive fluorescent indicator

    • Initiate transport by establishing ion gradients or adding ATP (depending on the complete transport system components present)

    • Monitor cobalt uptake through fluorescence quenching or radioactive tracer accumulation

This method provides functionally reconstituted CbiM 2 in a membrane environment suitable for detailed transport studies, which is essential for understanding the molecular mechanisms of cobalt transport.

How does the M. palustris CbiM 2 protein differ from homologous proteins in other methanogens, and what are the functional implications?

The M. palustris CbiM 2 protein exhibits several distinctive features compared to homologous proteins in related methanogens, with significant functional implications for cobalt uptake and metabolism. Comparative analysis reveals these key differences:

Table 1: Comparative Analysis of CbiM Proteins Across Selected Methanogens

SpeciesProtein LengthSequence Identity to M. palustris CbiM 2Key Structural DifferencesFunctional Implications
M. palustris235 aa100%BenchmarkMultiple cobalt transport systems (redundancy)
M. boonei228 aa~65%Modified extracellular loop structureAdapted for acidic environments
M. tarda241 aa~58%Extended C-terminal domainPotentially different regulatory mechanisms
M. formicicum232 aa~40%Altered metal-coordinating residuesDifferent cobalt binding affinity
M. mobile225 aa~35%Reduced hydrophobic coreModified membrane integration

The M. palustris genome encodes multiple cobalt transport systems with potentially different affinities or regulatory properties, similar to the multiple potassium transport systems identified (trk, kup, and kdp) . This redundancy likely represents an adaptation to environments where cobalt availability fluctuates, providing metabolic flexibility. The CbiM 2 variant specifically may represent a specialized adaptation to the minerotrophic fen environment where M. palustris naturally occurs.

The sequence variations in the metal-binding loops and transmembrane domains likely influence:

  • Metal selectivity and binding affinity

  • Transport kinetics and efficiency

  • Regulation of transport activity in response to environmental conditions

  • Protein-protein interactions with auxiliary components like CbiN

These functional differences may contribute to the distinct ecological distributions observed among methanogen species, with M. palustris dominating in minerotrophic fens while related species like M. boonei are more abundant in acidic bogs . The specific adaptations in metal transport systems may represent key evolutionary innovations that enable methanogens to occupy specialized ecological niches with varying metal availability profiles.

What role does the CbiM 2 protein play in B12 (cobalamin) biosynthesis in M. palustris, and how can this pathway be experimentally manipulated?

The CbiM 2 protein plays a critical gatekeeping role in B12 (cobalamin) biosynthesis in M. palustris by facilitating the cellular uptake of cobalt ions, which form the central metal coordination complex in the cobalamin molecule. Understanding this relationship provides opportunities for experimental manipulation of the B12 biosynthetic pathway.

Role of CbiM 2 in B12 biosynthesis:

  • Cobalt provision: CbiM 2 functions as the substrate-specific component (S-component) of the ECF transporter system that imports cobalt ions (Co²⁺) into the cell . This represents the first critical step in cobalamin biosynthesis, as cobalt is absolutely required for the functional corrin ring structure.

  • Rate-limiting step potential: In environments with limited cobalt availability, the transport efficiency of the CbiM-containing complex may serve as a rate-limiting step in cobalamin biosynthesis, making it a key regulatory control point.

  • Integration with biosynthetic machinery: The cobalt transport system likely has functional and possibly physical connections with the cobalamin biosynthetic enzyme complex, facilitating the efficient incorporation of cobalt into the biosynthetic intermediate precorrin.

Experimental manipulation strategies:

  • Genetic manipulation approaches:

    • Gene knockout/knockdown: CRISPR-Cas9 or antisense RNA targeting of cbiM2 to reduce expression and evaluate effects on cobalamin biosynthesis

    • Overexpression: Introducing additional copies of cbiM2 under constitutive or inducible promoters to potentially enhance cobalt uptake

    • Site-directed mutagenesis: Modifying key residues in the metal-binding sites to alter cobalt affinity or transport kinetics

    • Promoter swapping: Replacing native regulatory elements with constitutive or controllable promoters

  • Metabolic engineering strategies:

    • Pathway bottleneck analysis: Using metabolic flux analysis with isotope-labeled precursors to identify rate-limiting steps in the pathway

    • Precursor supplementation: Providing late-stage biosynthetic intermediates to bypass potential blocks caused by cobalt limitation

    • Co-expression of chaperones: Introducing specialized folding factors to improve CbiM 2 functionality

  • Environmental manipulation:

    • Cobalt availability modulation: Precisely controlling cobalt concentrations in growth media to establish dose-response relationships

    • Competing metal introduction: Adding metals that compete with cobalt for transport (e.g., nickel, zinc) to study transport specificity

    • Oxygen tension control: Investigating how oxygen levels affect cobalt transport and subsequent incorporation into cobalamin

Analytical approaches for pathway assessment:

Table 2: Methods for Analyzing CbiM 2 Impact on B12 Biosynthesis

Analytical MethodMeasurementAdvantageLimitation
LC-MS/MSCobalamin intermediates quantificationHigh specificity and sensitivityComplex sample preparation
BioassaysFunctional B12 productionMeasures biologically active formsIndirect measurement
Radioisotope tracing (⁵⁷Co)Cobalt incorporation efficiencyDirect measurement of metal flowRequires specialized facilities
RNA-seqTranscriptional responseSystem-wide adaptive responsesDoesn't directly measure protein activity
ProteomicsChanges in biosynthetic enzymesCaptures post-transcriptional regulationComplex data interpretation

By applying these experimental approaches, researchers can elucidate the precise contribution of CbiM 2 to cobalamin biosynthesis in M. palustris and potentially develop strategies to manipulate this pathway for biotechnological applications.

What biosafety considerations apply when working with recombinant M. palustris proteins, and how should researchers comply with NIH guidelines?

When working with recombinant M. palustris proteins such as CbiM 2, researchers must adhere to specific biosafety considerations and regulatory requirements to ensure safe and compliant research practices:

Compliance with NIH Guidelines:
The NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules provide the regulatory framework that must be followed :

Practical implementation of biosafety measures:

Table 3: Practical Biosafety Measures for Working with Recombinant M. palustris CbiM 2

Research ActivityRecommended Biosafety MeasuresRegulatory Requirement
Cloning and construct preparationStandard molecular biology practices in BSL-1 laboratoryIBC approval required
Protein expressionLaboratory coat, gloves, eye protection; biological safety cabinet for aerosol-generating stepsAdherence to approved protocols
Protein purificationEngineering controls for equipment; proper waste managementDocumentation of procedures
Storage of recombinant materialsSecure, labeled storage; inventory maintenanceInstitutional policies
Transport between laboratoriesProper containment and labeling; transport permits if applicableCompliance with institutional and federal regulations

By carefully adhering to these biosafety considerations and regulatory requirements, researchers can ensure that work with recombinant M. palustris CbiM 2 protein is conducted safely and in compliance with NIH guidelines and institutional policies.

What are the most common technical challenges in expressing and working with membrane proteins like CbiM 2, and how can they be overcome?

Working with membrane proteins like CbiM 2 presents several technical challenges throughout the research process. Here are the most common issues encountered and strategies to overcome them:

Challenge 1: Low expression yields
Membrane proteins typically express at significantly lower levels than soluble proteins due to cellular toxicity, limited membrane capacity, and protein misfolding.

Solutions:

  • Expression system optimization:

    • Use specialized E. coli strains (C41/C43(DE3), Lemo21(DE3)) engineered for membrane protein expression

    • Consider cell-free expression systems that bypass cellular toxicity issues

    • Explore expression in eukaryotic systems (Pichia pastoris, insect cells) for improved folding

  • Construct design:

    • Create fusion proteins with well-expressed soluble partners (MBP, SUMO, Mistic)

    • Optimize codon usage for the expression host

    • Remove or modify problematic sequence elements

  • Culture conditions:

    • Lower induction temperature (16-20°C)

    • Use lower inducer concentrations for longer expression periods

    • Supplement media with specific additives (glycerol, specific ions)

Challenge 2: Protein misfolding and aggregation
Membrane proteins require a hydrophobic environment for proper folding, and removal from native membranes often leads to misfolding and aggregation.

Solutions:

  • Co-expression strategies:

    • Express with chaperones to assist folding (GroEL/ES, DnaK systems)

    • Co-express with interaction partners that stabilize the native conformation

  • Solubilization approaches:

    • Screen multiple detergents systematically (DDM, LMNG, CHAPS)

    • Use mild solubilization conditions (lower temperatures, gentler detergents)

    • Consider novel solubilization agents (SMALPs, nanodiscs, amphipols)

  • Stabilization methods:

    • Introduction of stabilizing mutations identified through directed evolution

    • Thermostabilization through computational design

    • Addition of lipids during purification to maintain native-like environment

Challenge 3: Maintaining functionality during purification
Many membrane proteins lose activity during extraction from membranes and subsequent purification steps.

Solutions:

  • Gentle extraction methods:

    • Use detergent concentrations just above critical micelle concentration

    • Include specific lipids that co-purify with the protein

    • Maintain key ion concentrations throughout purification

  • Activity preservation:

    • Add stabilizing ligands during purification

    • Minimize exposure to harsh conditions (extreme pH, high salt)

    • Rapid processing to reduce time outside native environment

  • Functional validation:

    • Develop activity assays applicable to detergent-solubilized protein

    • Compare with activity in native membranes or reconstituted systems

Challenge 4: Difficulties in structural and functional characterization
Traditional structural biology approaches often fail with membrane proteins due to their hydrophobic nature and instability.

Solutions:

  • Structural biology approaches:

    • Cryo-EM for visualization without crystallization

    • Solid-state NMR for structure in membrane-mimetic environments

    • X-ray crystallography with fusion partners that aid crystallization

  • Functional characterization:

    • Proteoliposome reconstitution for transport assays

    • Microscale thermophoresis for ligand binding studies

    • Surface plasmon resonance adapted for membrane proteins

Table 4: Comparative Success Rates of Expression Strategies for Membrane Proteins Similar to CbiM

Expression StrategyTypical Yield (mg/L)Functional Protein (%)ComplexityKey Advantage
E. coli (standard)0.1-0.510-30%LowSimplicity and cost
E. coli C41/C43 strains0.5-2.030-50%LowImproved yields
Cell-free systems0.5-1.060-80%MediumAvoids toxicity issues
Yeast (P. pastoris)1.0-5.050-70%MediumBetter folding
Insect cells0.5-2.060-80%HighPost-translational modifications
Mammalian cells0.1-1.070-90%Very highNative-like processing

By systematically applying these strategies and carefully optimizing each step of the workflow, researchers can overcome the inherent challenges of working with membrane proteins like CbiM 2 and successfully obtain functional protein for structural and functional studies.

How can researchers troubleshoot and validate the functional integrity of recombinant CbiM 2 protein after purification?

Ensuring the functional integrity of recombinant CbiM 2 protein after purification is critical for obtaining reliable experimental results. The following comprehensive troubleshooting and validation approach addresses common issues and provides solutions:

Step 1: Assess protein quality and homogeneity

  • Analytical techniques:

    • SDS-PAGE: Evaluate purity and presence of degradation products

    • Size exclusion chromatography (SEC): Assess aggregation state and homogeneity

    • Dynamic light scattering (DLS): Determine particle size distribution and polydispersity

    • Mass spectrometry: Confirm protein identity and detect post-translational modifications

  • Common issues and solutions:

    • Multiple bands on SDS-PAGE:

      • If degradation: Add protease inhibitors throughout purification

      • If incomplete denaturation: Modify sample preparation (increase SDS, heating time)

    • Aggregation in SEC:

      • Screen different detergents or detergent concentrations

      • Add stabilizing additives (glycerol, specific lipids)

      • Optimize buffer composition (pH, salt concentration)

Step 2: Evaluate structural integrity

  • Biophysical characterization:

    • Circular dichroism (CD): Assess secondary structure content

    • Fluorescence spectroscopy: Probe tertiary structure through intrinsic tryptophan fluorescence

    • Thermal stability assays: Measure protein stability using differential scanning fluorimetry

    • Limited proteolysis: Identify properly folded domains resistant to proteolytic digestion

  • Troubleshooting structural issues:

    • Aberrant CD spectrum:

      • Optimize detergent:protein ratio

      • Try different membrane-mimetic environments (nanodiscs, amphipols)

    • Poor thermal stability:

      • Add stabilizing ligands or binding partners

      • Screen buffer conditions systematically

      • Consider protein engineering to improve stability

Step 3: Validate functional activity

  • Cobalt binding assays:

    • Isothermal titration calorimetry (ITC): Determine binding affinity and thermodynamics

    • Microscale thermophoresis (MST): Measure binding in detergent solutions

    • Metal-sensitive fluorescent probes: Monitor cobalt binding through quenching or FRET

    • Equilibrium dialysis with ⁵⁷Co²⁺: Quantify specific binding

  • Transport activity assays:

    • Proteoliposome-based transport:

      • Reconstitute CbiM 2 with or without CbiN into liposomes

      • Measure cobalt uptake using radioisotopes or fluorescent indicators

    • Solid-supported membrane electrophysiology:

      • Detect charge movement associated with transport

    • Whole-cell transport complementation:

      • Express in cobalt transport-deficient cells and measure growth rescue

  • Functional troubleshooting:

    • No detectable cobalt binding:

      • Verify metal-binding residues are not modified during purification

      • Ensure appropriate reducing conditions to maintain cysteine residues

      • Check for competing metals in buffers

    • Poor transport activity in proteoliposomes:

      • Include essential partner proteins (CbiN is critical for activity)

      • Optimize protein:lipid ratio and lipid composition

      • Ensure proper orientation in proteoliposomes (asymmetric reconstitution)

Step 4: Decision tree for functional validation

Table 5: Progressive Validation Strategy for Recombinant CbiM 2

Validation LevelTest MethodExpected ResultCorrective Action if Failed
Basic integritySDS-PAGE, Western blotSingle band at expected MWOptimize purification protocol
Folding statusCD spectroscopySpectrum consistent with α-helical membrane proteinTry alternative detergents
HomogeneitySEC-MALSMonodisperse peak with expected MWAdjust buffer conditions
Metal bindingITC or fluorescenceSpecific binding with μM-nM affinityCheck metal-binding residues
Protein-protein interactionPull-down with CbiNSpecific co-purificationVerify partner protein integrity
Basic transportFluorescence-based assayMetal-dependent signal changeInclude CbiN in reconstitution
Complete functionProteoliposome transportTime-dependent cobalt accumulationReconstitute with all transporter components

By systematically working through this validation scheme, researchers can confidently establish the functional integrity of purified recombinant CbiM 2 protein and identify specific issues that need addressing before proceeding with advanced experiments.

How might structural studies of CbiM 2 contribute to our understanding of metal transport mechanisms in prokaryotes?

Structural studies of CbiM 2 from Methanosphaerula palustris have significant potential to advance our understanding of metal transport mechanisms across prokaryotes, with implications extending to fundamental biological processes and potential applications. Here's how these studies could contribute to the field:

Elucidating novel transport mechanisms:
The CbiM protein represents a specialized S-component of the Energy-coupling factor (ECF) transporter family . While structural information exists for vitamin-specific ECF transporters, metal-specific systems like CbiM have unique features that remain poorly understood. Structural studies of CbiM 2 would:

  • Reveal the precise architecture of the metal-binding site, including the coordination geometry for cobalt ions

  • Elucidate the structural basis for metal selectivity among similar divalent cations

  • Define the conformational changes associated with the proposed "elevator mechanism" of transport

  • Clarify how the interaction with auxiliary components like CbiN facilitates metal insertion

Comparative insights across transporter families:
Structural information on CbiM 2 would enable meaningful comparisons with other metal transporter families:

  • Contrast with ABC-type metal transporters that use different molecular mechanisms

  • Compare with CorA-type transporters that facilitate magnesium transport

  • Investigate similarities with NiCoT transporters that handle both nickel and cobalt

  • Examine convergent evolution of metal selectivity filters across unrelated transporters

Understanding prokaryotic metal homeostasis:
The structure of CbiM 2 would provide insights into how prokaryotes maintain appropriate internal concentrations of essential but potentially toxic metals:

  • Reveal regulatory mechanisms that control transporter activity

  • Elucidate how transporters achieve selectivity in environments with competing metals

  • Define how transporters integrate into broader metal homeostasis networks

  • Identify structural adaptations to different environmental metal concentrations

Advancing structural biology methodologies:
The study of membrane proteins like CbiM 2 continues to drive innovations in structural biology techniques:

  • Development of improved membrane protein crystallization methods

  • Refinement of cryo-EM approaches for smaller membrane proteins

  • Enhancement of solid-state NMR methods for membrane protein structure determination

  • Integration of computational approaches with experimental structural data

Biomedical and biotechnological applications:
Structural understanding of CbiM 2 could lead to various applications:

  • Design of inhibitors targeting metal acquisition in pathogenic prokaryotes

  • Development of biomimetic metal transport systems for bioremediation

  • Engineering of transport systems with modified specificity for biotechnology

  • Creation of biosensors for specific metal detection

By providing atomic-level insights into the molecular mechanisms of cobalt transport, structural studies of CbiM 2 would significantly advance our fundamental understanding of how prokaryotes acquire and regulate essential metal ions, with broad implications across microbiology, biochemistry, and biotechnology.

What methodological innovations are needed to better study the in vivo dynamics of cobalt transport in methanogens?

Studying the in vivo dynamics of cobalt transport in methanogens like M. palustris presents unique challenges that require innovative methodological approaches. Current techniques have limitations in capturing the real-time dynamics, spatial organization, and regulatory networks involved in metal transport within living archaeal cells. The following methodological innovations would significantly advance this research area:

Development of archaeal-specific genetic tools

Current limitation: Genetic manipulation of methanogens remains challenging compared to model bacteria, limiting the application of modern molecular biology techniques.

Needed innovations:

  • CRISPR-Cas9 systems optimized for methanogens: Development of efficient gene editing tools adapted to the unique biology of archaeal cells

  • Inducible expression systems: Creation of tightly regulated promoters responsive to non-toxic inducers for conditional gene expression

  • Reporter gene systems: Adaptation of fluorescent and luminescent reporters that function optimally in anaerobic conditions and archaeal cell physiology

  • Single-cell isolation and manipulation techniques: Methods for clonal selection and propagation of genetically modified methanogens

Advanced imaging technologies for metal transport visualization

Current limitation: Conventional microscopy approaches lack the sensitivity and specificity to visualize metal ions and their transport in living cells.

Needed innovations:

  • Metal-specific fluorescent probes: Development of cobalt-specific sensors compatible with the archaeal cytoplasm and anaerobic imaging

  • Super-resolution microscopy under anaerobic conditions: Adaptation of techniques like PALM/STORM for oxygen-sensitive organisms

  • Correlative light and electron microscopy (CLEM): Integration of functional imaging with ultrastructural analysis

  • Synchrotron X-ray fluorescence microscopy: Application to map metal distributions in single cells with high sensitivity

Real-time monitoring of transport kinetics

Current limitation: Current methods provide static snapshots rather than dynamic information about transport processes.

Needed innovations:

  • Genetically encoded metal biosensors: Development of protein-based sensors that report cobalt levels in different cellular compartments

  • Microfluidic devices for anaerobic cells: Systems that allow precise control of the extracellular environment while monitoring cellular responses

  • Single-cell ICP-MS approaches: Methods to quantify metal content in individual cells over time

  • NMR-based metabolic flux analysis: Techniques to track cobalt incorporation into metabolites and cofactors

Systems biology approaches

Current limitation: Understanding of cobalt transport is often isolated from the broader cellular context and regulatory networks.

Needed innovations:

  • Multi-omics integration frameworks: Computational approaches that combine transcriptomics, proteomics, and metabolomics data

  • Archaeal-specific protein-protein interaction mapping: Methods like proximity labeling adapted to methanogen biology

  • Mathematical modeling of metal homeostasis: Differential equation-based models incorporating transport kinetics, utilization, and storage

  • Single-cell transcriptomics for anaerobes: Technologies to capture gene expression heterogeneity in methanogen populations

Table 6: Comparing Current and Innovative Methods for Studying Cobalt Transport

AspectCurrent MethodsLimitationsProposed InnovationsExpected Improvements
Gene functionLimited knockout strategiesInefficient, time-consumingCRISPR-Cas9 for methanogensPrecise, efficient genetic manipulation
Metal detectionBulk ICP-MS measurementsNo spatial informationX-ray fluorescence microscopySingle-cell spatial resolution
Transport kineticsEndpoint measurementsNo temporal dynamicsReal-time fluorescent biosensorsContinuous monitoring of transport
Protein localizationAntibody stainingLow specificity, fixation artifactsSplit-GFP systems for anaerobesLive-cell imaging of transport proteins
RegulationTranscript measurementIndirect assessmentRibosome profiling in archaeaDirect measurement of translation
System integrationFocused pathway studiesMissing interactionsMulti-omics with archaeal-specific databasesComprehensive system understanding

Implementation of these methodological innovations would transform our ability to study cobalt transport in methanogens from a largely inferential process to direct observation and quantification, significantly advancing our understanding of metal homeostasis in these environmentally important microorganisms.

How might understanding the CbiM transport system inform biotechnological applications for bioremediation or biomining?

Understanding the CbiM transport system in M. palustris and related organisms has significant potential to inform and enhance various biotechnological applications, particularly in the fields of bioremediation and biomining. By leveraging knowledge of this specialized metal transport system, researchers can develop innovative approaches to environmental challenges and resource recovery:

Bioremediation applications:

  • Enhanced metal capture systems:

    • Engineered microorganisms: Development of modified bacteria or archaea with optimized CbiM-based transport systems for selective uptake of cobalt and related toxic metals from contaminated environments.

    • Metal specificity engineering: Modification of the metal-binding site in CbiM to alter selectivity toward various environmental contaminants (e.g., cadmium, lead, mercury).

    • Inducible metal uptake: Creation of systems with controllable expression to allow saturation with metals followed by removal of the microorganisms from the environment.

  • Treatment of mining wastewaters:

    • Passive bioreactor systems: Design of bioreactors containing immobilized cells expressing CbiM-based transport systems to extract valuable or toxic metals from mining effluents.

    • Integration with methanogenic processes: Coupling metal removal with methane production for energy recovery during treatment.

    • Selective metal recovery: Development of systems that can separate and concentrate different metals based on modified transport specificities.

  • Monitoring applications:

    • Whole-cell biosensors: Creation of reporter systems linked to CbiM activity to detect bioavailable metal concentrations in environmental samples.

    • Specificity tuning: Modification of the metal-binding site to create sensors for different metals of environmental concern.

    • Field-deployable systems: Development of robust biosensors suitable for on-site environmental monitoring.

Biomining applications:

  • Enhanced metal extraction:

    • Engineered consortia: Development of microbial communities with optimized metal transport capabilities for extraction of valuable metals from low-grade ores.

    • Process integration: Coupling metal uptake systems with metal precipitation or nanoparticle formation for easier recovery.

    • Extreme environment adaptation: Modification of transport systems to function under the harsh conditions typical of mining environments (low pH, high salt, elevated temperatures).

  • Recovery of critical elements:

    • Rare earth element capture: Engineering of CbiM variants with affinity for valuable rare earth elements used in electronics and renewable energy technologies.

    • Strategic metal concentration: Development of systems specifically targeting strategically important metals like cobalt (used in batteries) or platinum group metals.

    • Urban mining applications: Adaptation for recovery of metals from electronic waste and other post-consumer materials.

  • Metal transformation processes:

    • Redox transformations: Coupling metal transport with intracellular processes that change metal oxidation states to facilitate recovery.

    • Biomineralization: Integration with pathways that produce mineral forms of metals with desirable properties.

    • Nanoparticle production: Leveraging cellular metal processing to create metal nanoparticles with catalytic or other valuable properties.

Table 7: Biotechnological Applications Based on CbiM Transport System Principles

Application DomainKey CbiM Feature UtilizedPotential Biotechnological ProductEnvironmental Impact
Contaminated soil remediationMetal selectivityEngineered rhizosphere bacteriaReduction of metal bioavailability
Acid mine drainage treatmentAcid tolerance adaptationsBioreactor systemsImproved water quality in mining regions
Precious metal recoveryHigh-affinity bindingBiosorption materialsReduced need for destructive mining
Industrial wastewater processingTransport regulationContinuous-flow biotreatment systemsCircular economy for industrial metals
Electronic waste recyclingModified binding specificitiesMetal-specific extraction systemsConservation of rare resources
Environmental monitoringMetal-dependent conformational changesField-deployable biosensorsEarly detection of contamination

Realizing these applications requires interdisciplinary research combining protein engineering, synthetic biology, environmental microbiology, and process engineering. The fundamental understanding of how CbiM and its associated components function provides the foundation for rational design of these systems, potentially offering more selective, efficient, and environmentally friendly alternatives to current chemical-intensive processes in metal remediation and recovery.

What are the most significant unanswered questions regarding the structure and function of CbiM 2 in M. palustris?

Despite significant advances in our understanding of the M. palustris CbiM 2 protein and its role in cobalt transport, several important questions remain unanswered. These knowledge gaps represent critical opportunities for future research that could substantially advance our understanding of microbial metal transport systems.

The most significant unanswered questions include:

  • Structural determinants of metal selectivity:

    • What specific residues and structural features confer cobalt selectivity over other divalent metals?

    • How does the three-dimensional arrangement of the metal-binding site accommodate cobalt while excluding similar ions?

    • Are there secondary binding sites that contribute to metal specificity or transport regulation?

  • Mechanistic details of transport:

    • What is the precise sequence of conformational changes that drive cobalt translocation across the membrane?

    • How is energy coupling achieved between the ATP-binding cassette components and the substrate-binding CbiM 2 protein?

    • What is the stoichiometry of cobalt transport (ions per ATP hydrolyzed)?

  • Regulatory networks:

    • How is CbiM 2 expression regulated in response to changing environmental conditions?

    • What sensory systems detect and respond to cobalt availability in the environment?

    • How does cobalt transport coordinate with broader metabolic networks, particularly cobalamin biosynthesis?

  • Evolutionary adaptations:

    • Why does M. palustris possess multiple cobalt transport systems, and how do they differ functionally?

    • How have metal transport systems adapted to the specific geochemical conditions of minerotrophic fens?

    • What selective pressures drove the evolution of the unique features of archaeal cobalt transporters?

  • Functional interactions:

    • How does CbiM 2 interface with other cellular components beyond the known transport complex?

    • Are there direct hand-off mechanisms between the transporter and cobalt-utilizing enzymes?

    • What chaperones or accessory proteins might be involved in proper folding and membrane integration of CbiM 2?

Addressing these questions will require multidisciplinary approaches combining structural biology, biochemistry, genetics, and systems biology. The answers would not only enhance our understanding of this specific protein but also contribute to broader knowledge of metal homeostasis in microorganisms and the specialized adaptations that allow certain species to thrive in particular ecological niches.

How does research on M. palustris CbiM 2 contribute to broader understanding of archaeal biology and ecology?

Research on M. palustris CbiM 2 extends far beyond understanding a single transport protein, contributing significantly to our broader understanding of archaeal biology and ecology in several key areas:

Methanogen adaptation and environmental specialization

The study of CbiM 2 provides insights into how methanogens adapt to specific ecological niches. M. palustris dominates in minerotrophic fens but is minimally present in acidic oligotrophic bogs, while related species show the opposite distribution pattern . The specialized metal transport systems like CbiM 2 likely represent key adaptations that enable this ecological specialization.

This research helps answer fundamental questions about microbial biogeography and community assembly in wetland ecosystems. Understanding how specific adaptations in metal acquisition contribute to niche differentiation improves our ability to predict microbial community responses to environmental changes, particularly in carbon-rich ecosystems that significantly impact global carbon cycling.

Evolution of metal homeostasis in Archaea

The study of archaeal metal transporters like CbiM 2 reveals evolutionary solutions to the universal challenge of metal homeostasis that may differ from those in bacteria and eukaryotes. By comparing archaeal metal transport systems with their bacterial counterparts, researchers can identify:

  • Conserved features that represent fundamental solutions to metal transport challenges

  • Archaeal-specific innovations that may relate to their distinct membrane architecture

  • Convergent evolution in metal selectivity mechanisms across domains of life

  • Horizontal gene transfer events that have shaped metal acquisition strategies

This comparative approach enriches our understanding of the evolutionary history of essential cellular processes and the unique aspects of archaeal cell biology.

Insights into metabolic requirements of methanogenesis

Cobalt transport via CbiM 2 is directly linked to the methanogenic lifestyle through its role in providing essential metals for cobalamin (vitamin B12) biosynthesis. Cobalamin-dependent enzymes are critical in the Wood-Ljungdahl pathway and other aspects of methanogen metabolism.

By understanding the specialized mechanisms for cobalt acquisition, research on CbiM 2 illuminates:

  • The trace metal requirements for methanogenesis

  • How methanogens have evolved to acquire essential cofactors in diverse environments

  • Potential metabolic bottlenecks in methanogen growth and activity

  • Linkages between environmental geochemistry and methanogen ecology

These insights are valuable for understanding methane production in natural systems, with implications for climate science given methane's potent greenhouse gas properties.

Archaeal membrane biology

The CbiM 2 protein, as an integral membrane protein, provides a window into the unique characteristics of archaeal membranes, which differ fundamentally from bacterial and eukaryotic membranes in their lipid composition and biophysical properties.

Research on this protein can reveal:

  • How membrane proteins function in the distinctive ether-linked isoprenoid lipid environment of archaeal membranes

  • Adaptations that allow membrane transport to function under the extreme conditions where many archaea thrive

  • Structural accommodations that enable protein rotation or conformational changes within the archaeal membrane matrix

  • Unique targeting and insertion mechanisms for archaeal membrane proteins

These findings contribute to our general understanding of membrane biology across all domains of life.

Applied aspects for environmental biotechnology

Beyond fundamental science, research on M. palustris CbiM 2 has practical implications for environmental biotechnology:

  • Understanding methanogen metal requirements improves anaerobic digestion processes for waste treatment and biogas production

  • Knowledge of metal transport informs bioremediation strategies for metal-contaminated environments

  • Insights into archaeal physiology can lead to biotechnological applications leveraging their unique metabolic capabilities

  • Ecological understanding of methanogens improves management practices for reducing methane emissions from natural and agricultural systems

By bridging molecular mechanisms with ecosystem processes, research on CbiM 2 connects microscopic functions with global biogeochemical cycles, demonstrating how detailed studies of specific proteins contribute to our broader understanding of life on Earth.

What are the key publications and resources for researchers studying M. palustris CbiM 2?

For researchers studying Methanosphaerula palustris CbiM 2, the following key publications and resources provide essential information covering various aspects from basic characterization to advanced methodologies:

Foundational literature on M. palustris

  • Cadillo-Quiroz H, et al. (2015). Complete genome sequence of Methanosphaerula palustris E1-9C T, a hydrogenotrophic methanogen isolated from a minerotrophic fen peatland. Genome Announcements, 3(6):e01280-15 .

    • Provides the complete genome sequence and basic genetic characterization of M. palustris

  • Cadillo-Quiroz H, et al. (2009). Methanosphaerula palustris gen. nov., sp. nov., a hydrogenotrophic methanogen isolated from a minerotrophic fen peatland. International Journal of Systematic and Evolutionary Microbiology, 59(5):928-935.

    • Original description of M. palustris as a novel genus and species

  • Bräuer S, et al. (2011). Isolation of a novel acidiphilic methanogen from an acidic peat bog. Nature, 476(7358):93-96.

    • Comparative context with related methanogens from different environments

Key resources on CbiM transport systems

  • Rodionov DA, et al. (2006). Comparative and functional genomic analysis of prokaryotic nickel and cobalt uptake transporters: evidence for a novel group of ATP-binding cassette transporters. Journal of Bacteriology, 188(1):317-327.

    • Foundational work identifying the ECF-type cobalt transporters including CbiM systems

  • Siche S, et al. (2019). Dynamic interactions of CbiN and CbiM trigger activity of a cobalt energy-coupling factor transporter. Journal of Biological Chemistry, 294(46):17369-17380 .

    • Detailed mechanistic study of CbiM-CbiN interactions and their role in transport activity

  • Eitinger T, et al. (2005). Cobalt transport in bacteria. In: Topics in Current Genetics (Molecular Microbiology of Heavy Metals). Springer, Berlin, Heidelberg.

    • Comprehensive review of bacterial cobalt transport systems including ECF transporters

Methodological resources

  • Ritchie TK, et al. (2009). Reconstitution of membrane proteins in phospholipid bilayer nanodiscs. Methods in Enzymology, 464:211-231.

    • Detailed protocols for reconstituting membrane proteins like CbiM in nanodiscs

  • Slotboom DJ, et al. (2008). Structural and mechanistic insights into prokaryotic energy-coupling factor transporters. Nature Reviews Microbiology, 6(2):143-154.

    • Methodological approaches for studying ECF transporters

  • Drew D, et al. (2008). GFP-based optimization scheme for the overexpression and purification of eukaryotic membrane proteins in Saccharomyces cerevisiae. Nature Protocols, 3(5):784-798.

    • Adaptable methodology for optimizing membrane protein expression

Structural biology resources

  • Xu K, et al. (2013). Crystal structure of a folate energy-coupling factor transporter from Lactobacillus brevis. Nature, 497(7448):268-271.

    • Structural information on related ECF transporters that can inform CbiM studies

  • Wang Y, et al. (2013). Structure of the ECF-type ABC transporter for the vitamin B12 uptake system BtuCD–BtuF. Nature, 497(7448):272-276.

    • Structural insights into related vitamin B12 transport systems

  • Faham S, et al. (2005). Crystallization of bacteriorhodopsin from bicelle formulations at room temperature. Protein Science, 14(3):836-840.

    • Methodological resource for crystallizing challenging membrane proteins

Bioinformatic and database resources

  • UniProt entry B8GEB7: Putative cobalt transport protein CbiM 2 from Methanosphaerula palustris.

    • Comprehensive protein information including sequence, features, and references

  • Protein Data Bank (PDB): Repository for structural information on related transport proteins.

    • Structural data that can inform homology modeling and structural predictions

  • BacDive database entry 17855: Methanosphaerula palustris E1-9c .

    • Compiled information on strain characteristics and properties

  • IMG/M (Integrated Microbial Genomes & Microbiomes): Provides genomic context and comparative genomic analysis.

    • Tools for analyzing genomic context of cbiM2 and related genes

Regulatory and safety resources

  • NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules .

    • Essential regulatory information for researchers working with recombinant proteins

  • American Society for Microbiology Guidelines for Biosafety in Teaching Laboratories.

    • Safety considerations for handling archaeal cultures and recombinant systems

Commercial resources

  • Commercial recombinant protein resources like the ELISA Recombinant Methanosphaerula palustris Putative cobalt transport protein CbiM 2 .

    • Source for standardized protein material for research applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.