Recombinant Methanospirillum hungatei Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Description

Introduction

Methanospirillum hungatei is a methanogenic archaeon known for its ability to convert complex organic matter into methane, water, and carbon dioxide in municipal wastewater . The CrcB protein is involved in fluoride resistance in various bacterial species . Recombinant Methanospirillum hungatei Protein CrcB homolog 1 (CrcB1) refers to a CrcB1 protein that has been produced using recombinant DNA technology, allowing for its isolation and study in controlled environments.

Methanospirillum hungatei and its S-Layer

Methanospirillum hungatei cells are spiral-shaped rods, approximately 0.4 to 0.5 μm in diameter and around 7 μm long, possessing polar flagella that facilitate motility . These cells are encased by a proteinaceous S-layer, which functions similarly to the cell walls of Gram-positive and Gram-negative bacteria . The outer sheath layer further encapsulates multiple M. hungatei cells, forming chains that can extend up to 500 μm in length .

The S-layer of M. hungatei is a flexible hexagonal lattice composed of dome-shaped tiles, uniformly spaced from both the outer cell sheath and the underlying cell membrane . Subtomogram averaging has resolved the S-layer hexamer tile at a resolution of 6.4 angstroms . By fitting an AlphaFold model, researchers have uncovered intra- and intertile interactions that contribute to the S-layer's cylindrical and flexible architecture, as well as a spacer extension for cell membrane attachment .

CrcB1 Homologs and Fluoride Resistance

CrcB proteins are known to play a role in fluoride resistance in various bacterial species . Sequence homology analysis of eriC and crcB genes in oral streptococci has identified two types of eriC genes (eriC1 and eriC2) and two types of crcB genes (crcB1 and crcB2) . The eriC1 gene product exhibits approximately 50% similarity with EriC of P. syringae DC3000, which has been identified as a fluoride channel protein . Similarly, both crcB products show around 50% similarity with CrcB of E. coli K-12, which is involved in fluoride resistance .

Recombinant Production and Applications

Recombinant CrcB1 protein can be produced in host organisms like E. coli using recombinant DNA technology . This involves cloning the crcB1 gene into an expression vector and introducing it into the host organism, which then produces the protein. Recombinant proteins are useful for various applications:

  • Structural Studies: Recombinant CrcB1 can be purified and crystallized for X-ray crystallography or studied using other biophysical techniques to determine its three-dimensional structure.

  • Functional Assays: The purified protein can be used in in vitro assays to study its function, such as fluoride transport or interaction with other proteins.

  • Drug Discovery: Recombinant CrcB1 can be used as a target for drug discovery efforts, with potential applications in developing new antibacterial agents or modulating fluoride resistance.

  • Vaccine Development: Recombinant CrcB1 protein may be useful for vaccine development .

Methanospirillum hungatei Physiology

Methanospirillum hungatei is characterized nutritionally and biochemically to understand its physiological similarities to other methanogenic bacteria . It grows well in a medium containing mineral salts, a cysteine sulfide reducing buffer, and an H2-CO2 atmosphere . The addition of amino acids and B vitamins can stimulate its growth . Cell-free extracts of M. hungatei contain methylcobalamin-coenzyme M methyltransferase, methylreductase, and formate hydrogenlyase . The cells also contain coenzyme M and coenzyme F420, with coenzyme F420 being required for formate hydrogenlyase activity .

CREB1 and Coronavirus Interaction

cAMP-responsive element-binding protein (CREB1) interacts directly with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) helicase non-structural protein 13 (nsp13) and potentiate its ATPase and helicase activity . By live SARS-CoV-2 virus infection, the inhibition of CREB1 dramatically impairs SARS-CoV-2 replication in vivo . The IC50 of CREB1 inhibitor 666-15 is comparable to that of remdesivir .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
crcB1; Mhun_1098; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Target Names
crcB1
Target Protein Sequence
MCLNIFRTFKSYFGCNITFVPKESALVGIGGCIGSVARYQINEWIPSLLGTFIVNVLGCI AIGFLMYESIYFGAFSRNSRLFLGAGLIGSFTTFSAFATQTIEAGLFYGIIFIAANILCG LMGVFIGRQIILRGRRSWNI
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and its associated toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal growth conditions for Methanospirillum hungatei cultures prior to protein isolation?

Methanospirillum hungatei demonstrates optimal growth in a defined medium consisting of mineral salts supplemented with a cysteine sulfide reducing buffer under an H2-CO2 (80:20) atmosphere. Research has shown that the addition of amino acids and B vitamins significantly stimulates growth . For laboratory cultivation, researchers typically maintain cultures at 37°C under strict anaerobic conditions, with regular monitoring using phase contrast microscopy. The growth medium requires careful preparation to ensure pre-reduction, which is critical for maintaining the anaerobic environment necessary for these methanogens.

When establishing cultures for subsequent protein isolation, it's essential to monitor growth to mid-logarithmic phase for optimal protein expression levels. Regular supplementation with H2-CO2 (twice weekly) supports continuous growth and ensures cells maintain metabolic activity .

How does the recombinant expression system for M. hungatei CrcB homolog 1 compare with that of similar archaeal membrane proteins?

Based on approaches used for similar archaeal membrane proteins, recombinant expression of M. hungatei CrcB homolog 1 typically employs E. coli as the heterologous host system. Drawing from successful expression strategies for the homologous protein from Methanosarcina acetivorans, which shares functional characteristics as a putative fluoride ion transporter, researchers often use N-terminal His-tagging for purification purposes .

The expression challenges for archaeal membrane proteins in bacterial hosts include:

ChallengeMitigation Strategy
Codon biasCodon optimization of synthetic gene constructs
Protein toxicityUse of tightly regulated inducible promoters
Membrane integrationCo-expression with chaperones
Post-translational modificationsSelection of appropriate E. coli strains
Protein foldingLower induction temperatures (16-20°C)

When expressing archaeal membrane proteins like CrcB homolog 1, researchers must consider the fundamental differences between archaeal and bacterial membrane composition and protein-processing machinery.

How can researchers distinguish between functional and non-functional forms of recombinantly expressed M. hungatei CrcB homolog 1?

Distinguishing functional from non-functional forms of recombinantly expressed membrane proteins requires multiple complementary approaches:

  • Fluoride sensitivity assays: Expressing the protein in fluoride-sensitive E. coli strains lacking endogenous fluoride exporters, then monitoring growth in increasing fluoride concentrations.

  • Ion flux measurements: Using fluoride-selective electrodes or fluorescent probes to monitor ion movement in proteoliposomes reconstituted with the purified protein.

  • Structural integrity assessment: Circular dichroism spectroscopy to confirm proper secondary structure composition, particularly the α-helical content expected for transmembrane domains.

  • Thermal stability analysis: Differential scanning fluorimetry to assess protein stability and proper folding.

  • Binding assays: Using radioactive or fluorescently labeled fluoride analogs to measure specific binding to the purified protein.

A functional recombinant CrcB homolog should demonstrate specific, saturable fluoride transport activity that can be inhibited by known channel blockers or competitive inhibitors.

What purification strategies are most effective for obtaining high-yield, functionally active recombinant M. hungatei CrcB homolog 1?

Purification of membrane proteins like CrcB homolog 1 requires specialized approaches to maintain structural integrity and function. Based on successful strategies for similar archaeal membrane proteins, the following protocol can be implemented:

  • Cell lysis optimization: Gentle disruption methods (e.g., osmotic shock, enzymatic digestion) rather than sonication or high-pressure homogenization to preserve membrane protein structure.

  • Detergent screening: Systematic evaluation of detergents for solubilization:

Detergent ClassExamplesAdvantages
Mild non-ionicDDM, LMNGMaintains protein-protein interactions
ZwitterionicCHAPS, Fos-cholineEfficient solubilization
Steroid-basedDigitonin, CholateMimics native membrane environment
  • Affinity chromatography: Utilizing His-tag affinity for initial capture, with careful optimization of imidazole concentrations to minimize non-specific binding while maximizing target protein recovery .

  • Size exclusion chromatography: To separate monomeric from aggregated protein and remove detergent micelles.

  • Alternative solubilization systems: Consider nanodiscs, amphipols, or styrene-maleic acid copolymer lipid particles (SMALPs) for detergent-free purification.

The purified protein should be maintained in appropriate buffers with stabilizing agents similar to those used for the M. acetivorans homolog (Tris/PBS-based buffer with 6% trehalose at pH 8.0) . Storage recommendations include aliquoting with 5-50% glycerol for long-term storage at -20°C/-80°C to avoid repeated freeze-thaw cycles.

How can researchers effectively design functional assays to verify the fluoride transport activity of recombinant M. hungatei CrcB homolog 1?

Functional characterization of CrcB homolog 1 as a fluoride transporter requires robust assay systems:

  • Fluoride-specific probes: Utilize fluorescent probes that respond to fluoride concentration changes, such as:

    • PBFI (potassium-binding benzofuran isophthalate) adapted for fluoride sensitivity

    • Genetically encoded fluoride sensors

  • Reconstitution systems:

    • Proteoliposomes with defined lipid composition

    • Giant unilamellar vesicles (GUVs) for single-molecule studies

    • Planar lipid bilayers for electrophysiological measurements

  • Transport kinetics measurement:

    • Initial rate measurements at varying substrate concentrations

    • Determination of Km and Vmax values

    • Inhibition studies with known fluoride channel blockers

  • Complementation studies:

    • Expression in fluoride-sensitive bacterial strains

    • Rescue of fluoride sensitivity as functional verification

  • Mutagenesis approach:

    • Site-directed mutagenesis of predicted pore-lining residues

    • Correlation of structural alterations with functional changes

The assay design should include appropriate controls, including empty vesicles, heat-inactivated protein, and known fluoride transporters as positive controls.

How does the amyloidogenic potential of CrcB homolog 1 compare with the Major sheath protein A (MspA) in M. hungatei?

While the primary function of CrcB homolog 1 is believed to be fluoride ion transport, it's instructive to compare its structural properties with the well-characterized Major sheath protein A (MspA) from M. hungatei, which forms functional amyloid structures.

MspA is a 40.6 kDa (377 amino acid) protein that forms the protective sheath structure surrounding M. hungatei cells . Unlike typical membrane channels, MspA demonstrates highly amyloidogenic properties that enable it to form regular, striated tubular structures with cross-β-sheet characteristics, as confirmed by FTIR spectroscopy .

When analyzing potential amyloidogenic regions using computational tools similar to AmylPred2, researchers should examine CrcB homolog 1 for:

  • Regularly spaced amyloidogenic regions similar to those observed in MspA

  • Potential for intermolecular disulfide bond formation (noting that MspA contains a single cysteine residue at position 271 that forms intermolecular disulfide bonds)

  • Sequence motifs associated with β-sheet formation and amyloid propensity

Unlike MspA, which requires harsh conditions (DTT combined with 1M NaOH) for depolymerization , CrcB homolog 1 likely exhibits conventional membrane protein characteristics without extensive amyloid-like properties, given its putative role as an ion channel rather than a structural protein.

What functional relationships might exist between CrcB homolog 1 and the mercury methylation pathway proteins HgcA and HgcB in M. hungatei?

M. hungatei JF-1 has been shown to methylate mercury at comparable rates but with higher yields than some sulfate- and iron-reducing bacteria . This mercury methylation capability is attributed to the presence of HgcA and HgcB proteins.

Potential functional relationships between CrcB homolog 1 and the mercury methylation pathway may include:

  • Ion homeostasis coordination: CrcB homolog 1 may contribute to maintaining ion balance necessary for optimal HgcA/HgcB function.

  • Stress response integration: Fluoride and mercury detoxification systems may share regulatory mechanisms as part of a broader metal/metalloid resistance network.

  • Energy coupling: Both systems may interact with cellular energetics, particularly considering the methanogenic lifestyle of M. hungatei.

Experimental approaches to investigate these potential relationships include:

  • Co-immunoprecipitation studies to identify physical interactions

  • Transcriptomic analysis to identify co-regulation under various stress conditions

  • Phenotypic characterization of genetic knockouts

  • Fluorescence resonance energy transfer (FRET) studies with fluorescently tagged proteins to examine in vivo proximity

While direct evidence for functional interaction is limited, both systems represent important aspects of M. hungatei environmental adaptation.

What methodological approaches are most effective for studying the integration of M. hungatei CrcB homolog 1 into artificial membrane systems?

Studying membrane protein integration requires specialized techniques that balance protein stability with functional assessment:

  • Lipid composition optimization:

    • Screening of archaeal-like lipid compositions

    • Incorporation of archaeol and caldarchaeol lipids to mimic native environment

    • Systematic variation of membrane fluidity and thickness

  • Reconstitution methods:

    • Detergent-mediated reconstitution with controlled detergent removal

    • Direct incorporation during liposome formation

    • Fusion of proteoliposomes with preformed membrane systems

  • Orientation control strategies:

    • pH gradient-driven insertion

    • Electroporation-assisted reconstitution

    • Asymmetric reconstitution using cyclodextrin-mediated methods

  • Verification techniques:

    • Protease protection assays to confirm topology

    • Fluorescence quenching to assess accessibility

    • Freeze-fracture electron microscopy to visualize distribution

  • Functional assessment in artificial systems:

    • Fluoride ion flux measurements using ion-selective electrodes

    • Patch-clamp electrophysiology of reconstituted channels

    • Stopped-flow fluorescence spectroscopy with ion-sensitive dyes

The systematic optimization of these methodologies allows for reliable study of CrcB homolog 1 structure-function relationships in defined membrane environments.

How can researchers leverage M. hungatei CrcB homolog 1 for biotechnological applications in fluoride bioremediation?

The potential application of CrcB homolog 1 in fluoride bioremediation leverages its putative role as a fluoride transporter:

  • Engineered whole-cell bioremediation systems:

    • Overexpression of CrcB homolog 1 in robust bacterial hosts

    • Development of immobilization matrices for cell-based remediation

    • Engineering of regulatory systems for fluoride-responsive expression

  • Biomembrane-based filtration technologies:

    • Incorporation of purified CrcB into stable lipid bilayers

    • Development of biomimetic membranes with enhanced fluoride selectivity

    • Creation of hybrid protein-polymer membrane systems

  • Protein engineering approaches:

    • Structure-guided mutagenesis to enhance transport rates

    • Stability engineering for function under environmental conditions

    • Fusion with affinity tags for immobilization on remediation materials

  • Performance metrics and optimization:

ParameterOptimization ApproachMeasurement Method
Transport rateDirected evolutionIon-selective electrodes
StabilityDisulfide engineeringThermal denaturation studies
SelectivityPore lining residue modificationCompetitive transport assays
CapacityExpression level enhancementQuantitative Western blotting

Implementation requires careful consideration of protein stability under environmental conditions and integration with established remediation technologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.