Recombinant Methanospirillum hungatei Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please specify it in your order; we will prioritize fulfilling this request.
Synonyms
crcB2; Mhun_1099; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Target Names
crcB2
Target Protein Sequence
MEHLILVGIGGAVGAMLRFELSKLRPVRSIPLGTALVNIIGSSLFGCVVFSRSPGDIFYL VDVGILGGFTTFSTFSFETFRMFEEQDYQTMVLNISINLIGSLIGVLLSFILVTLILTGG
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for maintaining crcB2 protein stability?

For optimal stability, the recombinant Methanospirillum hungatei Protein CrcB homolog 2 should be stored in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for this protein. Short-term storage should be at -20°C, while extended storage requires conservation at either -20°C or -80°C to maintain protein integrity. Working aliquots can be stored at 4°C for up to one week .

It is strongly recommended to avoid repeated freezing and thawing cycles as this can lead to protein degradation and loss of activity. Researchers should prepare small working aliquots to minimize freeze-thaw cycles .

How does Methanospirillum hungatei differ from other methanogenic archaea?

Methanospirillum hungatei is distinguished from other methanogenic archaea by several key characteristics. It belongs to the class Methanomicrobia, which constitutes the late-evolving methanogenic lineage . One distinctive feature is its growth within proteinaceous tubular sheaths that protect the cells from environmental stressors .

Additionally, M. hungatei has been identified as capable of mercury methylation, a metabolic trait not commonly associated with methanogens. This places it in a new guild of Hg-methylating microbes with potential ecological significance in mineral-poor anoxic freshwater environments .

What are the recommended protocols for the purification of recombinant crcB2 protein?

While the search results don't provide a specific purification protocol for crcB2, based on standard practices for similar recombinant proteins from archaea, the following methodology is recommended:

  • Initial Extraction: Harvest cells expressing recombinant crcB2 and resuspend in a Tris-based lysis buffer (typically 50 mM Tris-HCl, pH 8.0, 150 mM NaCl) with protease inhibitors.

  • Cell Disruption: Use sonication or mechanical disruption methods, keeping samples cold to prevent protein degradation.

  • Affinity Chromatography: Since the tag type is determined during the production process , use an appropriate affinity resin based on the specific tag (His-tag, GST, etc.).

  • Buffer Exchange: Dialyze or use gel filtration to exchange into the final Tris-based storage buffer with 50% glycerol.

  • Quality Control: Verify protein purity using SDS-PAGE and Western blotting with antibodies specific to the tag or to the crcB2 protein.

  • Activity Assay: Develop a functional assay to confirm that the purified protein retains its native activity.

How should researchers design experiments to investigate potential interactions between crcB2 and other cellular components?

When investigating potential interactions between crcB2 and other cellular components, researchers should consider the following experimental design approach:

  • In silico Analysis: Begin with bioinformatic prediction of potential interaction partners based on:

    • Protein structure prediction

    • Sequence homology with known interacting proteins

    • Co-expression data analysis

  • Pull-down Assays: Use the purified tagged recombinant crcB2 protein as bait to capture potential interaction partners from M. hungatei lysates or heterologous expression systems.

  • Yeast Two-Hybrid Screening: Employ Y2H systems adapted for archaeal proteins to identify potential protein-protein interactions.

  • Co-immunoprecipitation: Develop antibodies against crcB2 or use tag-specific antibodies to co-precipitate interaction partners from cell lysates.

  • Crosslinking Studies: Utilize chemical crosslinkers to stabilize transient interactions before purification and mass spectrometry analysis.

  • Microscopy Approaches: Design fluorescently tagged versions of crcB2 for co-localization studies with potential partners using advanced microscopy techniques.

  • Functional Validation: Confirm the biological relevance of identified interactions through knockout/knockdown studies and functional complementation assays.

What is the current understanding of the functional role of crcB2 in Methanospirillum hungatei?

The CrcB family of proteins are generally involved in fluoride ion export and resistance mechanisms in bacteria and archaea. They function as fluoride ion channels that export toxic fluoride ions from the cytoplasm, protecting cells from fluoride toxicity. Given the conservation of this protein family, crcB2 in M. hungatei may have a similar role in ion transport and cellular protection against environmental toxins.

It's worth noting that M. hungatei contains multiple homologs of various proteins, as evidenced by the presence of six homologs of the identified MspA sheath protein in its genome . This suggests that crcB2 may be part of a larger family of related proteins with potentially specialized or redundant functions within this organism.

What expression systems are most effective for producing functional recombinant crcB2?

Based on general principles for archaeal protein expression and the nature of the protein, the following expression systems are recommended for producing functional recombinant crcB2:

  • E. coli Expression Systems:

    • BL21(DE3) with codon optimization for archaeal proteins

    • Arctic Express or similar strains for low-temperature expression to improve protein folding

    • C41/C43(DE3) strains specifically designed for membrane-associated proteins

  • Yeast Expression Systems:

    • Pichia pastoris for proteins requiring post-translational modifications

    • Saccharomyces cerevisiae with archaeal protein-specific promoters

  • Cell-Free Expression Systems:

    • PURE system supplemented with archaeal chaperones

    • Wheat germ extract systems for difficult-to-express proteins

  • Expression Optimization Parameters:

    • Induction at lower temperatures (16-25°C)

    • Addition of specific osmolytes or stabilizing agents

    • Use of fusion partners such as MBP or SUMO to enhance solubility

  • For Membrane-Associated Proteins:

    • Addition of detergents or lipid nanodiscs during purification

    • Use of specialized membrane protein expression vectors

The choice of expression system should be guided by the intended downstream applications and the structural characteristics of the crcB2 protein.

How can researchers effectively analyze the membrane topology and localization of crcB2?

To effectively analyze the membrane topology and subcellular localization of crcB2, researchers should employ a multi-faceted approach:

  • Computational Prediction:

    • Use membrane protein topology prediction servers (TMHMM, TOPCONS, MEMSAT)

    • Analyze hydrophobicity plots to identify potential transmembrane regions

    • Employ signal peptide prediction tools to identify targeting sequences

  • Biochemical Approaches:

    • Protease protection assays with isolated membrane fractions

    • Chemical labeling of accessible residues before and after membrane permeabilization

    • Selective membrane extraction using different detergents

  • Reporter Fusion Strategies:

    • Generate fusion proteins with topology-reporting tags (PhoA, GFP, split-GFP)

    • Create systematic truncations to map membrane-spanning regions

    • Employ reporter proteins that are active only in specific cellular compartments

  • Microscopy Methods:

    • Immunofluorescence microscopy using anti-tag or anti-crcB2 antibodies

    • Super-resolution microscopy for precise localization

    • Electron microscopy with immunogold labeling for ultrastructural localization

  • In vivo Crosslinking:

    • Site-specific incorporation of photo-crosslinkable amino acids

    • Analysis of crosslinked products to identify neighboring proteins

The combination of these approaches can provide comprehensive information about the membrane topology and subcellular localization of crcB2 in Methanospirillum hungatei.

How might crcB2 contribute to the mercury methylation capability observed in Methanospirillum hungatei?

While a direct link between crcB2 and mercury methylation has not been established in the provided search results, the question prompts important considerations for researchers investigating this relationship.

Methanospirillum hungatei JF-1 has been demonstrated to methylate mercury with higher yields than some sulfate- and iron-reducing bacteria, particularly in sulfide-free conditions . This methylation capability is attributed to the hgcA and hgcB genes (encoding a corrinoid iron-sulfur protein and a 2[4Fe-4S] ferredoxin, respectively), which are essential for mercury methylation .

Potential connections between crcB2 and mercury methylation that researchers might investigate include:

  • Membrane Transport Functions: If crcB2 functions as a membrane transporter, it could potentially facilitate the uptake of Hg(II) ions into the cell or the export of methylmercury, affecting methylation efficiency.

  • Redox Balance: The mercury methylation process involves redox reactions. If crcB2 participates in cellular redox homeostasis, it could indirectly influence methylation capacity.

  • Regulatory Relationships: Researchers should investigate whether crcB2 expression is co-regulated with hgcA and hgcB under conditions that promote mercury methylation.

  • Protein-Protein Interactions: Determining whether crcB2 physically interacts with HgcA, HgcB, or other components of the mercury methylation machinery would be valuable.

Experimental approaches to investigate these possibilities could include:

  • Knockout/knockdown studies of crcB2 followed by mercury methylation assays

  • Co-expression analysis of crcB2 with hgcA and hgcB under various environmental conditions

  • Protein interaction studies between crcB2 and known mercury methylation proteins

What are the structural and functional differences between crcB2 and its homologs in other Methanospirillum species?

The search results indicate that homologs of certain proteins exist across Methanospirillum species, suggesting similar patterns may exist for crcB2. Researchers investigating the differences between crcB2 and its homologs should consider:

  • Sequence Comparison Analysis:

    • Perform multiple sequence alignments of crcB2 homologs from related species including M. stamsii Pt1, M. lacunae Ki8-1 C, and M. tarda NOBI-1

    • Identify conserved domains and variant regions that may indicate functional specialization

    • Calculate evolutionary distances to understand the divergence patterns

  • Structural Prediction and Comparison:

    • Generate homology models for each crcB homolog

    • Compare predicted three-dimensional structures, focusing on active sites or binding pockets

    • Analyze differences in surface charge distribution and hydrophobicity patterns

  • Functional Comparison Through Heterologous Expression:

    • Express different crcB homologs in a model organism

    • Conduct complementation assays to determine functional equivalence

    • Measure specific activity parameters to identify differences in functionality

  • Comparative Transcriptomics and Proteomics:

    • Analyze expression patterns of different crcB homologs under various conditions

    • Determine if homologs have developed specialized functions through differential regulation

    • Identify co-expressed genes that might indicate functional networks

The presence of multiple homologs within a single species (as observed with the MspA protein, which has six homologs in M. hungatei JF-1, seven in M. stamsii Pt1, and fifteen in M. lacunae Ki8-1 C ) suggests possible functional diversification that deserves thorough investigation.

How can structural studies of crcB2 contribute to understanding its potential role in the unique sheath formation of Methanospirillum hungatei?

The search results indicate that Methanospirillum hungatei grows within distinctive proteinaceous tubular sheaths with amyloid-like properties . While crcB2 is not directly identified as a sheath protein in the provided information, researchers might investigate potential relationships between crcB2 and sheath formation through the following approaches:

  • Structural Characterization:

    • Determine if crcB2 contains structural motifs common to known sheath proteins

    • Analyze whether crcB2 has characteristics of membrane-anchored proteins that might interface with sheath components

    • Investigate potential amyloid-forming regions within crcB2 sequence using predictive algorithms

  • Localization Studies:

    • Determine if crcB2 co-localizes with sheath structures using immunogold electron microscopy

    • Analyze the distribution of crcB2 relative to cell division sites where new sheath material is deposited

    • Examine whether crcB2 interacts with known sheath components through proximity labeling approaches

  • Functional Investigations:

    • Create crcB2 deletion mutants and observe effects on sheath formation

    • Analyze whether crcB2 expression correlates with sheath production phases

    • Test if crcB2 modulates the assembly or properties of the amyloid-like sheath structures

  • Protein Interaction Network Analysis:

    • Identify potential interactions between crcB2 and the 40.6 kDa MspA-like protein (WP_011449234.1) identified as a major sheath component

    • Map the protein-protein interaction network surrounding crcB2 and sheath proteins

    • Determine if crcB2 participates in the transport or processing of sheath components

The tubular sheaths of M. hungatei are composed of individual rings with distinctive mechanical properties, tending to fracture longitudinally between hoops . Understanding whether crcB2 contributes to these structural characteristics could provide insights into both protein function and archaeal cell envelope assembly.

How does the evolutionary history of crcB2 relate to the late-evolving methanogenic lineage of Methanomicrobia?

The search results indicate that Methanospirillum hungatei belongs to the Methanomicrobia class, which constitutes the late-evolving methanogenic lineage . Researchers investigating the evolutionary history of crcB2 within this context should consider:

  • Phylogenetic Analysis:

    • Construct phylogenetic trees of crcB proteins across archaea, with particular focus on methanogenic lineages

    • Compare crcB2 evolution with 16S rRNA-based organismal phylogeny to identify potential horizontal gene transfer events

    • Analyze selection pressures on different domains of the protein through Ka/Ks ratios

  • Comparative Genomics:

    • Examine synteny of the genomic region containing crcB2 across related species

    • Identify co-evolved gene clusters that might indicate functional relationships

    • Compare genomic context of crcB homologs across early and late-evolving methanogenic lineages

  • Domain Architecture Analysis:

    • Determine if domain shuffling or fusion events have occurred during crcB evolution

    • Compare domain organization with homologs from bacteria and other archaeal lineages

    • Identify lineage-specific insertions or deletions that might correlate with functional adaptations

  • Correlation with Environmental Adaptations:

    • Analyze whether crcB2 sequence variations correlate with ecological niches of different methanogens

    • Investigate potential relationship between crcB2 evolution and adaptation to specific environmental stressors

    • Compare crcB2 sequences from methanogens living in diverse habitats (marine, freshwater, soil, etc.)

The late emergence of this methanogenic lineage in evolutionary history offers an opportunity to understand how proteins like crcB2 might have adapted to changing environmental conditions, particularly the gradual oxygenation of Earth's atmosphere and its effects on redox-sensitive metabolic pathways.

What insights can proteomics approaches provide about the expression and regulation of crcB2 under different environmental conditions?

Understanding the expression and regulation of crcB2 under various environmental conditions can provide valuable insights into its physiological role. Researchers should consider the following proteomics approaches:

  • Global Proteome Analysis:

    • Compare proteome profiles of M. hungatei grown under different nutritional conditions

    • Analyze changes in crcB2 abundance in response to stress factors (pH, temperature, toxins)

    • Quantify crcB2 expression levels during different growth phases

  • Post-translational Modification (PTM) Mapping:

    • Identify potential PTMs on crcB2 using high-resolution mass spectrometry

    • Determine if PTM patterns change under different environmental conditions

    • Investigate the functional consequences of identified modifications through site-directed mutagenesis

  • Protein-Protein Interaction Networks:

    • Use affinity purification-mass spectrometry (AP-MS) to identify crcB2 interaction partners

    • Determine if interaction networks reconfigure under different environmental conditions

    • Map condition-specific interaction landscapes using BioID or APEX proximity labeling

  • Targeted Proteomics for Quantification:

    • Develop selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) assays for absolute quantification of crcB2

    • Compare crcB2 abundance across different methanogenic species under identical conditions

    • Track crcB2 dynamics during adaptation to changing environments

  • Spatial Proteomics:

    • Analyze subcellular distribution of crcB2 under different growth conditions

    • Determine if relocalization occurs in response to specific environmental cues

    • Correlate spatial distribution with functional activity

These proteomics approaches can be particularly valuable when examining potential roles of crcB2 in stress responses, including its possible involvement in mechanisms like mercury methylation, which varies significantly with environmental conditions such as the presence of sulfide .

What are common challenges in working with recombinant crcB2 and how can researchers overcome them?

Working with archaeal proteins like crcB2 presents several challenges that researchers should be prepared to address:

  • Solubility Issues:

    • Challenge: Recombinant crcB2 may form inclusion bodies or aggregate during expression.

    • Solutions:

      • Express at lower temperatures (16-20°C)

      • Use solubility-enhancing fusion tags (MBP, SUMO, Trx)

      • Add compatible solutes (glycerol, trehalose) to buffer systems

      • Consider membrane-mimicking environments if it's a membrane-associated protein

  • Protein Stability:

    • Challenge: crcB2 may be unstable after purification.

    • Solutions:

      • Optimize storage buffer composition (50% glycerol is recommended )

      • Add reducing agents if the protein contains cysteines

      • Determine and maintain optimal pH range

      • Consider addition of specific ligands or cofactors that might stabilize the protein

  • Functional Assays:

    • Challenge: Lack of established assays to verify crcB2 activity.

    • Solutions:

      • Develop thermal shift assays to screen stabilizing conditions

      • Establish binding assays for potential substrates or interaction partners

      • Create reporter systems for transport function if crcB2 is a transporter

      • Design complementation assays in model organisms

  • Structural Characterization:

    • Challenge: Difficulties in obtaining structural information.

    • Solutions:

      • Screen multiple constructs with varied terminal deletions

      • Use nanobodies or crystallization chaperones

      • Consider lipid cubic phase crystallization if it's a membrane protein

      • Employ cryo-EM for challenging proteins

  • Specific Activity:

    • Challenge: Low or variable specific activity in functional assays.

    • Solutions:

      • Ensure proper folding through circular dichroism analysis

      • Verify the presence of essential cofactors

      • Test activity under various buffer conditions and temperatures

      • Consider archaeal-specific factors that might be required for activity

How can researchers design effective controls when studying the potentially diverse functions of crcB2?

  • Sequence-Based Controls:

    • Positive Controls: Use well-characterized homologs from related species with known functions

    • Negative Controls: Create site-directed mutants targeting predicted functional residues

    • Specificity Controls: Test related but functionally distinct proteins from the same organism

  • Expression-Level Controls:

    • Overexpression Controls: Monitor effects of increasing crcB2 expression levels

    • Depletion Controls: Compare with knockdown or knockout phenotypes

    • Complementation Controls: Rescue experiments with wild-type and mutant versions

  • Subcellular Localization Controls:

    • Compartment Markers: Use established markers for different cellular compartments

    • Mislocalization Controls: Add or remove targeting sequences to alter localization

    • Fractionation Controls: Verify purification of specific cellular fractions using marker proteins

  • Interaction Studies Controls:

    • Bait Controls: Use unrelated proteins with similar properties as bait

    • Competition Controls: Perform competition assays with unlabeled protein

    • Domain Controls: Test individual domains to map interaction interfaces

  • Environmental Condition Controls:

    • Media Controls: Verify effects are not due to media components

    • Growth Phase Controls: Compare results across different growth phases

    • Stress Response Controls: Distinguish specific responses from general stress responses

  • Technical Controls:

    • Replicate Controls: Biological and technical replicates to ensure reproducibility

    • Antibody Controls: Validate antibody specificity with recombinant protein and knockout strains

    • Tag Interference Controls: Compare results with differently tagged versions and untagged protein

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.