Recombinant Methanospirillum hungatei UPF0290 protein Mhun_1107 (Mhun_1107)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics and Production

Recombinant Mhun_1107 is produced in Escherichia coli systems and purified for research applications. Key specifications include:

ParameterDetail
Molecular Weight~19.1 kDa (theoretical for 166 aa)
Amino Acid Sequence1–166 residues; includes conserved motifs (e.g., GXXG, R-rich regions)
TagDetermined during production (commonly His-tag for purification)
Storage BufferTris-based buffer with 50% glycerol
StabilityStable at -20°C/-80°C; avoid repeated freeze-thaw cycles

The full-length sequence begins with mLPAYLPNNFAALTGGGMPIDMGRNWTDGRRILGDGKTIRGFVGGVTAGILIGAVQMYAE... and terminates with ...KLGLKKVPW, suggesting potential β-strand-rich regions .

Genomic and Functional Context

Mhun_1107 is encoded by the Mhun_1107 gene in the 3.54 Mb circular genome of M. hungatei JF-1, which contains 3,239 protein-coding genes . While its exact role remains unconfirmed, several insights emerge:

  • Amyloidogenic Potential: Structural analogs in Methanospirillum (e.g., sheath protein MspA WP_011449234.1) exhibit amyloid-like properties critical for forming protective sheaths . Mhun_1107 shares sequence motifs with these functional amyloids, hinting at a role in structural assembly.

  • Homologs: Six MspA homologs exist in M. hungatei, though Mhun_1107 is not directly annotated as a sheath component .

  • Conservation: UPF0290 family proteins are widespread in methanogens, suggesting involvement in essential but understudied pathways .

Future Directions

Research priorities include:

  1. Biochemical Assays: Testing amyloidogenicity via Congo red binding or thioflavin T assays .

  2. Genetic Knockouts: Assessing phenotypic changes in Mhun_1107-deletion strains.

  3. Structural Studies: Cryo-EM or X-ray crystallography to resolve tertiary structure.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include your preferred format in order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is preferred, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
carS; Mhun_1107; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Target Names
carS
Target Protein Sequence
MLPAYLPNNFAALTGGGMPIDMGRNWTDGRRILGDGKTIRGFVGGVTAGILIGAVQMYAE ISGLVPWFPPHTLTAVILLAIGSLLGDMVKSFFKRRQGIDRGGEWFLVDQLDFVVGALLL TLLFDPIWMLNTMTIPLLIVILVLTPLLHRTVNIIGYKLGLKKVPW
Uniprot No.

Target Background

Function
This enzyme catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction represents the third ether-bond-formation step in the biosynthesis of archaeal membrane lipids.
Database Links
Protein Families
CDP-archaeol synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanospirillum hungatei UPF0290 protein Mhun_1107 and what is its significance in archaeal biology?

Methanospirillum hungatei UPF0290 protein Mhun_1107 is a protein encoded by the Mhun_1107 gene in the archaeon Methanospirillum hungatei strain JF-1/DSM 864, a methane-producing microorganism. The protein belongs to the UPF0290 family, which consists of proteins with unknown functions that are conserved across various archaeal species . M. hungatei is notable for its distinctive morphology, forming long chains of cells (up to 100 μm in length) enclosed within a sheath-like structure, with terminal cells possessing polar flagella .

The significance of Mhun_1107 lies in understanding the unique biochemical and physiological properties of methanogens. M. hungatei serves an important ecological role as a hydrogen- and/or formate-using partner in syntrophic relationships with many species of bacteria, contributing to biogenic methane production which is crucial in the global carbon cycle . Studying Mhun_1107 may provide insights into the mechanisms underlying these syntrophic partnerships and the archaeon's ability to thrive in anaerobic environments.

How does Methanospirillum hungatei's genome context inform research on Mhun_1107?

The complete genome sequence of M. hungatei strain JF1 provides critical context for understanding Mhun_1107's potential functions. The genome is circular, spanning 3,544,738 bp and containing 3,239 protein-coding genes and 68 RNA genes . This relatively large genome suggests the presence of unrecognized biochemical and physiological properties that likely extend to other Methanospirillaceae.

When researching Mhun_1107, scientists should consider its genomic neighborhood and potential operon structures that might indicate functional relationships with other genes. M. hungatei contains four 16S rRNA genes with nearly identical sequences, differing at only two positions across the 1466 nucleotide length (positions 937 and 1382) . This genomic context can inform primer design for gene expression studies and help identify potential regulatory elements affecting Mhun_1107 expression.

The phylogenetic classification of M. hungatei provides additional context:

MIGS IDPropertyTermEvidence code
Current classificationDomain ArchaeaTAS
Phylum EuryarchaeotaTAS
Class MethanomicrobiaTAS
Order MethanomicrobialesTAS
Family MethanospirillaceaeTAS
Genus MethanospirillumTAS
Species Methanospirillum hungateiTAS
Type strain JF-1TAS

This taxonomic information can guide comparative genomics approaches to identify conserved domains or motifs in Mhun_1107 that might hint at its function.

What experimental approaches are most effective for studying the function of an uncharacterized protein like Mhun_1107?

When investigating an uncharacterized protein like Mhun_1107, a multi-faceted experimental approach is recommended:

  • Computational analysis: Begin with bioinformatic approaches such as:

    • Sequence homology searches across archaeal and bacterial domains

    • Structural prediction and modeling

    • Identification of conserved domains and motifs

    • Genomic context analysis to identify potential functional partners

  • Expression and purification optimization:

    • Compare expression in different systems (E. coli, yeast, mammalian cells, or baculovirus)

    • Optimize purification protocols to achieve >85% purity

    • Validate protein integrity using SDS-PAGE and western blotting

  • Functional characterization:

    • Protein-protein interaction studies (pull-down assays, co-immunoprecipitation)

    • Subcellular localization in native organism (if possible) or heterologous system

    • Enzymatic activity assays based on predicted functions

    • Structural studies (X-ray crystallography, NMR)

  • Gene knockout or knockdown studies:

    • CRISPR-Cas9 or traditional homologous recombination approaches

    • Phenotypic characterization of mutants

    • Complementation studies to confirm phenotype-genotype relationships

How can researchers effectively design experiments to study Mhun_1107's potential role in syntrophic partnerships?

Studying Mhun_1107's potential role in syntrophic partnerships requires specialized experimental designs that account for the complex metabolic interactions between organisms:

  • Co-culture systems:

    • Establish defined co-cultures between M. hungatei and known syntrophic partners such as Syntrophobacter wolinii (propionate degrader), Syntrophomonas wolfei (butyrate degrader), or Syntrophus species (benzoate degraders)

    • Compare wild-type M. hungatei with Mhun_1107 mutants in co-culture performance

    • Monitor metabolite exchange using isotope labeling techniques

  • Interspecies electron transfer investigation:

    • Examine hydrogen and/or formate flux between partners

    • Investigate potential direct electron transfer mechanisms

    • Analyze gene expression changes in Mhun_1107 during syntrophic growth versus monoculture

  • Physiological parameter monitoring:

    • Track growth rates, methane production, and substrate utilization

    • Control hydrogen partial pressure to test effects on Mhun_1107 expression

    • Measure response to environmental stressors in presence/absence of syntrophic partners

A systematic experimental design matrix should include:

ParameterVariationsMeasurementsAnalysis Method
Growth conditionsTemperature (20-40°C), pH (6.0-8.0)Growth rate, protein expressionANOVA, regression
Co-culture partnersVarious syntrophic bacteriaMethane production, substrate utilizationPrincipal component analysis
Substrate availabilityH₂+CO₂, formate, acetateGene expression, protein activityPathway analysis
Genetic modificationsWild-type, Mhun_1107 knockout, overexpressionPhenotypic changes, partner growthComparative analysis

For statistically robust results, each experimental condition should be replicated at least in triplicate, with appropriate controls for mono-culture growth and abiotic factors .

What specialized techniques are required for expressing and purifying archaeal membrane proteins like Mhun_1107?

Expression and purification of archaeal membrane proteins like Mhun_1107 present unique challenges due to their hydrophobic nature and the significant differences between archaeal and bacterial/eukaryotic expression systems. Based on the amino acid sequence, Mhun_1107 contains multiple transmembrane domains, suggesting it is a membrane protein .

Recommended expression systems and approaches:

  • Expression system selection:

    • E. coli-based systems: BL21(DE3), C41(DE3), or C43(DE3) strains specifically developed for membrane protein expression

    • Alternative systems: Cell-free expression systems supplemented with archaeal lipids

    • Archaeal host expression: Homologous expression in related methanogenic archaea for proper folding

  • Vector and fusion tag optimization:

    • Test multiple fusion tags: His₆, MBP, SUMO, or GST tags

    • Consider tag position (N- or C-terminal) based on predicted topology

    • Use inducible promoters with fine-tuned expression levels

  • Membrane extraction and solubilization:

    • Test a panel of detergents for optimal solubilization:

    Detergent ClassExamplesCMC (mM)Applications
    Non-ionicDDM, OG, Triton X-1000.17, 23, 0.2Initial screening
    ZwitterionicLDAO, Fos-choline1.0, 1.5Crystallography
    Steroid-basedDigitonin, CHAPS0.5, 8.0Retaining complex interactions
    Novel agentsSMA copolymer, nanodiscsN/ANative-like environment
  • Purification strategy:

    • Two-step affinity purification followed by size exclusion chromatography

    • On-column detergent exchange during purification

    • Buffer optimization to include stabilizing additives such as glycerol

  • Protein quality assessment:

    • Circular dichroism spectroscopy to confirm secondary structure integrity

    • Differential scanning fluorimetry to assess thermal stability

    • Dynamic light scattering to evaluate homogeneity

    • Native-PAGE analysis to detect oligomeric states

These specialized techniques should be adapted to achieve the >85% purity standard necessary for subsequent structural and functional studies .

What methods can effectively elucidate the role of Mhun_1107 in M. hungatei's unique sheath structure formation?

M. hungatei's distinctive characteristic of forming chains of cells enclosed within a sheath-like structure presents an intriguing area for investigating potential roles of Mhun_1107. The amino acid sequence of Mhun_1107 suggests membrane association , which could be relevant to the formation or maintenance of this unique cellular architecture.

Methodological approaches for investigating Mhun_1107's role in sheath formation:

  • Localization studies:

    • Immunogold electron microscopy using antibodies against recombinant Mhun_1107

    • Fluorescent protein tagging (if genetically tractable system available)

    • Subcellular fractionation followed by western blotting

    • Proteomic analysis of isolated sheath structures

  • Genetic manipulation approaches:

    • Gene knockout or knockdown using CRISPR-Cas9 or homologous recombination

    • Complementation with mutant variants to identify critical domains

    • Overexpression studies to observe morphological effects

    • Heterologous expression in related methanogenic archaea lacking sheaths

  • Structural investigation of sheaths:

    • Cryo-electron microscopy and tomography of wild-type versus mutant cells

    • Atomic force microscopy for nanomechanical property assessment

    • Super-resolution microscopy for protein distribution patterns

    • Time-lapse microscopy to monitor sheath formation dynamics

  • Protein-protein interaction studies:

    • Pull-down assays with recombinant Mhun_1107 to identify binding partners

    • Bacterial/archaeal two-hybrid screening

    • Cross-linking mass spectrometry to identify in vivo interactions

    • Surface plasmon resonance to measure binding kinetics with candidate partners

The cell envelope of M. hungatei includes a surface layer coat (S-layer) surrounding the cytoplasmic membrane and an outermost sheath structure encapsulating multiple cells . Systematic analysis of Mhun_1107's interactions with components of these structures could reveal its contribution to the archaeon's unique morphology and cell-cell interactions that enable syntrophic partnerships.

How should researchers approach investigating Mhun_1107's potential role in methanogenesis and energy conservation?

Given M. hungatei's role in methane production from hydrogen/carbon dioxide and/or formate , exploring Mhun_1107's potential functions in methanogenesis requires a systematic approach combining biochemical, genetic, and physiological methods:

  • Metabolic pathway analysis:

    • ¹³C-labeling experiments to track carbon flux through methanogenesis pathways

    • Enzyme activity assays in the presence and absence of purified Mhun_1107

    • Membrane potential measurements in wild-type versus Mhun_1107 mutants

    • Hydrogen/formate consumption rates under various conditions

  • Genetic approaches:

    • Conditional expression systems to regulate Mhun_1107 levels

    • Targeted mutagenesis of conserved residues based on sequence analysis

    • Complementation with homologs from related methanogens

    • Transcriptional analysis under different growth conditions

  • Protein complex identification:

    • Blue native PAGE to isolate intact membrane complexes

    • Co-immunoprecipitation with known components of methanogenesis machinery

    • Chemical cross-linking followed by mass spectrometry

    • Comparative proteomics of membrane fractions

  • Bioenergetic characterization:

    • Measurement of proton/sodium translocation during methanogenesis

    • ATP synthesis rates in relation to Mhun_1107 expression levels

    • Electron transfer assays using artificial electron acceptors/donors

    • Growth yield determination under energy-limiting conditions

Experimental design considerations:

The optimal temperature range for M. hungatei growth is 20-40°C with an optimum at 37°C , which should guide experimental conditions. Growth media should include acetate as the major carbon source, and strictly anaerobic conditions must be maintained throughout all experiments.

A comprehensive experimental matrix incorporating these approaches would enable researchers to systematically evaluate Mhun_1107's role in the unique energy conservation mechanisms employed by methanogens for ATP synthesis and carbon fixation.

How can researchers leverage Mhun_1107 studies to advance understanding of interspecies syntrophic interactions?

Syntrophic partnerships between M. hungatei and various bacteria represent a fascinating area of microbial ecology and metabolism. These interactions, where M. hungatei functions as the hydrogen- and/or formate-using partner, are critical for degradation of fatty and aromatic acids in anaerobic environments . Studying Mhun_1107 in this context can advance our understanding of these complex interactions:

  • Co-culture experimental systems:

    • Establish defined syntrophic partnerships with bacteria such as Syntrophobacter wolinii (propionate degrader), Syntrophomonas wolfei (butyrate degrader), and Syntrophus species (benzoate degraders)

    • Develop continuous culture systems that allow real-time monitoring of metabolite exchange

    • Design microfluidic devices to study single-cell interactions and spatial organization

  • Comparative studies across syntrophic systems:

    • Analyze differential expression of Mhun_1107 when paired with different syntrophic partners

    • Compare interspecies electron transfer mechanisms across various partnerships

    • Investigate adaptation mechanisms during prolonged syntrophic growth

  • Environmental relevance investigations:

    • Study expression patterns in environmental samples where syntrophy occurs naturally

    • Develop molecular probes targeting Mhun_1107 for environmental monitoring

    • Create mathematical models predicting syntrophic dynamics in complex communities

  • Synthetic biology approaches:

    • Engineer artificial syntrophic systems with defined components

    • Modify Mhun_1107 expression or structure to enhance or alter syntrophic efficiency

    • Design biosensors based on Mhun_1107 regulation to monitor syntrophic interactions

Research impact assessment matrix:

Research FocusFundamental Knowledge GainEcological UnderstandingBiotechnological Applications
Mhun_1107 structure-functionMembrane protein biology in archaeaCell-cell interaction mechanismsDesign of artificial syntrophic systems
Metabolite exchangeEnergy conservation principlesNutrient cycling in anaerobic environmentsEnhanced biogas production
Interspecies communicationMolecular basis of mutualismCommunity assembly rulesSynthetic microbial consortia
Evolutionary aspectsCo-evolution of syntrophic partnersNiche differentiationDirected evolution for specific applications

These approaches would not only advance our understanding of Mhun_1107's specific role but also contribute to broader knowledge about the ecological and evolutionary significance of syntrophic partnerships in anaerobic environments and their applications in biotechnology.

What emerging technologies might revolutionize the study of archaeal proteins like Mhun_1107?

Several cutting-edge technologies are poised to transform research on archaeal proteins like Mhun_1107, opening new avenues for understanding their structure, function, and ecological significance:

  • Advanced structural biology techniques:

    • Cryo-electron microscopy for near-atomic resolution of membrane proteins without crystallization

    • Integrative structural biology combining multiple data sources (NMR, SAXS, mass spectrometry)

    • Hydrogen-deuterium exchange mass spectrometry for protein dynamics

    • Microcrystal electron diffraction for small crystals of membrane proteins

  • Single-cell technologies:

    • Single-cell proteomics to capture cell-to-cell variability in Mhun_1107 expression

    • Spatial transcriptomics to map gene expression in syntrophic aggregates

    • Live-cell imaging with archaeal-optimized fluorescent proteins

    • Nano-SIMS for tracking isotope incorporation at cellular resolution

  • Genome editing advances:

    • CRISPR-Cas systems optimized for archaeal hosts

    • Base editing and prime editing for precise genetic modifications

    • Inducible gene expression systems for methanogens

    • Cell-free archaeal expression systems for rapid protein production

  • Computational breakthroughs:

    • AI-driven protein structure prediction specifically trained on archaeal proteins

    • Molecular dynamic simulations in archaeal-mimetic membrane environments

    • Network analysis tools for interpreting multi-omics data

    • Quantum computing approaches for complex metabolic modeling

  • Biomimetic systems:

    • Archaeal lipid nanodiscs for native-like membrane protein studies

    • Microfluidic devices mimicking syntrophic interfaces

    • 3D bioprinting of defined microbial communities

    • Synthetic cells incorporating archaeal components

Implementation considerations for emerging technologies:

The integration of these emerging technologies will enable unprecedented insights into the structural basis of Mhun_1107's function, its dynamic interactions within the cell and with syntrophic partners, and its broader ecological significance in methanogenic communities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.