Recombinant Methanospirillum hungatei UPF0316 protein Mhun_0543 (Mhun_0543)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Mhun_0543; UPF0316 protein Mhun_0543
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Target Names
Mhun_0543
Target Protein Sequence
MDVGFLSSDLFTFGLIPVLIFLARICDVSIGTIRYIMISRGFKFIAPVFGFFEVTIWLLA IGQVMANITNPICYIAYGAGFAAGTYIGMELEERMKLGMAIIRLITPLPTEDFIARLRQY GYGVTNITAQGANGEVTIIFMVVKRAKIPHLAILIRDFNPHAFYTIEDVRSASEGIYPIE DKNNPFSIFKRPFLFIGKRK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanospirillum hungatei UPF0316 protein Mhun_0543?

Methanospirillum hungatei UPF0316 protein Mhun_0543 is a 200-amino acid protein from the anaerobic archaeon Methanospirillum hungatei strain JF-1/DSM 864. It belongs to the UPF0316 protein family, where UPF designates an uncharacterized protein family. The protein has a UniProt accession number of Q2FLQ6 and is encoded by the gene Mhun_0543 in the M. hungatei genome. While its precise function remains uncharacterized, research suggests it may be related to the distinctive tubular sheath structures that protect this methanogenic archaeon from environmental stressors . Methanospirillum hungatei, like other related methanogens, grows within proteinaceous tubular sheaths that exhibit amyloid-like properties, which likely contribute to their remarkable stability and protective function .

What are the optimal storage conditions for recombinant Mhun_0543?

For maintaining the stability and functionality of recombinant Methanospirillum hungatei UPF0316 protein Mhun_0543, proper storage conditions are critical. The recommended storage buffer consists of a Tris-based buffer with 50% glycerol, optimized specifically for this protein's stability. For long-term storage, the protein should be kept at -20°C or preferably at -80°C for extended preservation . For ongoing experiments requiring repeated access, working aliquots can be stored at 4°C for up to one week. It is strongly advised to avoid repeated freeze-thaw cycles as these can lead to protein degradation, aggregation, and loss of biological activity. Researchers should prepare small single-use aliquots upon receiving the protein to minimize exposure to detrimental temperature fluctuations and maintain experimental reproducibility across extended research timeframes.

How should researchers design experiments to characterize Mhun_0543 function?

For addressing the amyloid-like properties potentially associated with Mhun_0543, researchers should consider incorporating specialized techniques such as thioflavin T binding assays, Congo red birefringence, or circular dichroism spectroscopy to assess secondary structure characteristics. The experimental design should include appropriate controls, such as known amyloid-forming proteins and non-amyloid proteins, to validate findings. Replication across multiple independent experiments is essential to establish reliability and statistical significance of the observed phenomena. When designing these experiments, researchers should carefully document all variables and methodological details to ensure reproducibility and facilitate future meta-analyses or comparative studies.

What approaches can be used to create a comprehensive data table for Mhun_0543 experimental results?

When constructing data tables for Mhun_0543 experimental results, researchers should follow systematic principles that enhance clarity and facilitate interpretation. Begin by clearly identifying the independent and dependent variables in your experimental design. For studies on Mhun_0543, the independent variables might include experimental conditions (pH, temperature, salt concentration), protein concentration, interacting partners, or mutation sites, while dependent variables could include binding affinity measurements, structural parameters, or functional readouts3. A well-designed table should include a descriptive title that specifies both the independent and dependent variables along with any controlled variables that remain constant throughout the experiment.

Here is an example data table format for a hypothetical experiment measuring the effect of temperature on Mhun_0543 secondary structure:

Table 1: Secondary Structure Composition of Recombinant Mhun_0543 Protein at Different Temperatures

Temperature (°C)α-Helix (%)β-Sheet (%)Random Coil (%)Turn (%)Aggregation Index
2532.5 ± 1.241.3 ± 0.818.7 ± 1.57.5 ± 0.60.12 ± 0.02
3730.1 ± 1.443.6 ± 1.117.9 ± 1.38.4 ± 0.50.15 ± 0.03
5025.3 ± 2.148.7 ± 1.615.2 ± 1.710.8 ± 0.90.35 ± 0.05
6518.6 ± 2.555.9 ± 2.312.4 ± 1.913.1 ± 1.20.72 ± 0.08
8010.2 ± 3.164.7 ± 2.710.1 ± 2.015.0 ± 1.41.28 ± 0.11

Each data point represents mean ± standard deviation from five independent experiments.

When formatting your table, ensure that all measurements include appropriate units and error estimates, typically standard deviations or standard errors calculated from multiple replicates3. The table should be visually clear with consistent decimal places and adequate spacing. For complex experimental designs with multiple independent variables, consider creating hierarchical tables or multiple related tables that clearly show the relationships between variables. Additionally, all tables should be properly referenced in the text and include footnotes explaining any abbreviations, special conditions, or statistical methods used in data analysis.

What purification methods are most effective for isolating native Mhun_0543 from Methanospirillum hungatei cultures?

Purifying native Mhun_0543 from Methanospirillum hungatei cultures presents several challenges due to the organism's anaerobic growth requirements and the potential association of the protein with complex structural assemblies. Based on methodologies used for similar proteins in M. hungatei, researchers should first cultivate the organism in a defined pre-reduced synthetic acetate broth supplemented with 80% H₂ and 20% CO₂ maintained at 37°C under strict anaerobic conditions . Harvesting cells should be performed carefully to maintain protein integrity, typically through centrifugation at 10,000 × g for 15 minutes at 4°C. If the protein is indeed associated with the sheath structures, as suggested by homology to other M. hungatei proteins, then sheath isolation protocols may be needed before protein extraction.

For sheath isolation, differential centrifugation techniques can be employed, followed by treatment with detergents to remove membrane components while preserving the more resistant sheath structures. If Mhun_0543 is embedded within amyloid-like structures similar to other M. hungatei sheath proteins, researchers may need to employ depolymerization strategies such as treatment with reducing agents like DTT combined with strong bases such as 1M NaOH . Following depolymerization, conventional protein purification techniques including ion exchange chromatography, size exclusion chromatography, and affinity chromatography can be applied. Throughout the purification process, fractions should be analyzed using SDS-PAGE and western blotting with antibodies specifically raised against Mhun_0543 to track protein recovery. Mass spectrometry analysis of purified fractions can confirm protein identity and purity, while also potentially revealing any post-translational modifications or processing not evident from the gene sequence alone.

How does Mhun_0543 compare to homologous proteins in related methanogenic archaea?

The UPF0316 protein Mhun_0543 from Methanospirillum hungatei belongs to a protein family with several homologs across related methanogenic archaea. Genomic analyses reveal that M. hungatei JF-1 itself encodes six homologs of this protein, suggesting possible functional redundancy or specialization . Related strains also contain multiple homologs: Methanospirillum stamsii Pt1 possesses 7 homologs with sequence identities ranging from 28-66%, Methanospirillum lacunae Ki8-1 C contains 15 homologs with 29-60% sequence identity, and Methanolinea tarda NOBI-1 has 2 homologs with approximately 31% sequence identity . This pattern of multiple homologs within single genomes is consistent with gene duplication events followed by functional diversification, a common evolutionary strategy for proteins involved in structural roles or environmental adaptation.

Interestingly, when compared to the MspA protein from Methanosaeta thermophila PT, which forms the sheath structure in that organism, Mhun_0543 shows limited sequence similarity, with only 14% sequence identity and 23% sequence similarity . Despite this relatively low sequence conservation, both proteins may share structural and functional characteristics related to sheath formation. The presence of a single cysteine residue in Mhun_0543 may be functionally significant, as intermolecular disulfide bonds have been implicated in sheath integrity in related systems. The conservation pattern across homologs shows that certain regions of the protein sequence are more highly conserved than others, potentially highlighting functionally critical domains. Computational structural predictions suggest that these proteins likely share similar secondary structure elements despite sequence divergence, a phenomenon commonly observed in proteins where structure-function relationships are more conserved than primary sequence.

What evidence suggests Mhun_0543 might be involved in sheath formation in Methanospirillum hungatei?

While direct evidence linking Mhun_0543 specifically to sheath formation is limited in the provided search results, several indirect lines of evidence suggest a potential role in this process. The sheaths of Methanospirillum hungatei JF-1 have been characterized as regularly striated tubular structures with amyloid-like properties, similar to those observed in Methanosaeta thermophila PT . These protective sheaths shield the archaeal cells from environmental stressors and require specific proteins for their formation and maintenance. Studies with the amyloid-specific antibody WO1 demonstrate that M. hungatei is enclosed within a functional amyloid protective layer, confirming the amyloid nature of these sheaths .

Analysis of purified sheaths from M. hungatei JF-1 has identified a 40.6 kDa protein (WP_011449234.1) as a major component, which has been designated as Major sheath protein A (MspA) . Although this is not explicitly identified as Mhun_0543 in the search results, the pattern of homology among sheath proteins in related organisms suggests that Mhun_0543 may belong to the same protein family with similar structural roles. The extreme stability of M. hungatei sheaths, which require both reducing agents (DTT) and strong bases (NaOH) for disassembly, indicates the presence of intermolecular disulfide bonds between protein components . The single cysteine residue present in Mhun_0543 could potentially participate in such bonding, contributing to sheath integrity through similar mechanisms as observed with other sheath proteins. Additionally, the presence of multiple homologs in the genome suggests specialized roles in sheath formation, possibly at different stages of growth or in response to various environmental conditions.

How might researchers investigate potential protein-protein interactions involving Mhun_0543?

Investigating protein-protein interactions involving Mhun_0543 requires a multi-faceted approach that combines biochemical, biophysical, and computational methods. Researchers should first generate recombinant Mhun_0543 with appropriate affinity tags (such as His-tag or GST) to facilitate pull-down assays from M. hungatei lysates. These experiments can identify direct binding partners from the native cellular environment. For more targeted analyses, yeast two-hybrid (Y2H) screens or bacterial two-hybrid systems can be employed using Mhun_0543 as bait against a library of prey constructs from M. hungatei. Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can provide quantitative binding parameters such as association and dissociation constants for specific interaction partners.

For studying interactions in the context of sheath formation, researchers should consider crosslinking experiments using chemical crosslinkers of varying spacer arm lengths, followed by mass spectrometry analysis to identify proximity partners within the assembled structure. This technique is particularly valuable for capturing transient or weak interactions that might be lost during conventional co-immunoprecipitation procedures. Förster resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) assays using fluorescently tagged constructs can provide insights into interactions within living cells, though these techniques may require adaptation for the anaerobic culturing conditions required by M. hungatei. Computational predictions using tools like STRING, BioGRID, or specialized archaeal protein interaction databases can guide experimental designs by highlighting high-probability interaction partners based on co-expression patterns, genomic context, or structural homology to known interacting proteins.

What are the challenges in expressing and purifying recombinant Mhun_0543 for structural studies?

Expression and purification of recombinant Mhun_0543 for structural studies present numerous challenges that researchers must address systematically. As an archaeal protein potentially involved in structural assemblies with amyloid-like properties, Mhun_0543 may exhibit folding patterns that are difficult to recapitulate in conventional bacterial expression systems. Researchers should consider multiple expression systems, including specialized E. coli strains designed for membrane or toxic proteins, archaeal hosts like Thermococcus kodakarensis or Sulfolobus solfataricus, or eukaryotic systems for complex folding requirements. Codon optimization is essential when expressing archaeal genes in heterologous hosts, as codon usage bias can significantly impact expression levels and proper folding. Expression conditions should be carefully optimized, with particular attention to temperature, inducer concentration, and duration of induction to balance yield with proper folding.

For purification, researchers should anticipate challenges related to protein solubility and stability. If Mhun_0543 forms amyloid-like structures similar to other sheath proteins, it may have a strong tendency to aggregate during purification, necessitating the use of specialized solubilization agents or detergents. A multi-step purification strategy is typically required, potentially including immobilized metal affinity chromatography (IMAC), ion exchange chromatography, and size exclusion chromatography to achieve the high purity (>95%) needed for structural studies. Throughout the purification process, protein stability should be continuously monitored using techniques such as dynamic light scattering (DLS) to detect aggregation, and circular dichroism (CD) spectroscopy to confirm proper secondary structure formation. For X-ray crystallography studies, extensive crystallization screening may be necessary, with consideration of various additives that might stabilize specific conformations. For NMR studies, isotopic labeling (¹⁵N, ¹³C, ²H) will be required, adding another layer of complexity to the expression protocol.

How can researchers distinguish between functional and experimental artifacts when studying amyloid-like properties of Mhun_0543?

To control for artifactual aggregation during purification or storage, time-course experiments should be conducted to monitor protein behavior under experimental conditions. Fresh protein preparations should be compared with aged samples to identify time-dependent changes in aggregation or secondary structure. Environmental factors that might induce non-native aggregation, such as pH extremes, high salt concentrations, or elevated temperatures, should be systematically controlled and their effects documented. The use of amyloid-specific antibodies like WO1, which has been shown to bind to intact M. hungatei filaments, provides another tool to distinguish functional amyloids from non-specific aggregates . Mutagenesis studies targeting key residues predicted to be involved in amyloid formation can provide further evidence for the structural determinants of genuine functional amyloid assembly versus artifactual aggregation. Finally, comparative studies with known functional amyloids from related organisms, such as the MspA protein from M. thermophila PT, can help establish evolutionary patterns that support the functional nature of observed amyloid-like properties.

What approaches can be used to study the potential role of Mhun_0543 in the extreme stability of Methanospirillum hungatei sheaths?

The remarkable stability of Methanospirillum hungatei sheaths, which require both reducing agents and strong bases for disassembly, presents a fascinating research question regarding the structural contributions of component proteins like Mhun_0543. To investigate this protein's role in sheath stability, researchers should employ a comprehensive strategy combining genetic, biochemical, and biophysical approaches. Gene deletion or knockdown studies using CRISPR-Cas systems adapted for archaeal hosts would provide direct evidence of Mhun_0543's importance by revealing phenotypic changes in sheath formation, integrity, or stability. Site-directed mutagenesis targeting the single cysteine residue in Mhun_0543 would specifically address the role of disulfide bonding in stability, as these bonds have been implicated in linking protein hoops together in sheath structures .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.