Recombinant Methanothermobacter marburgensis Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant ehaA

Recombinant Methanothermobacter marburgensis Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA) is a bioengineered protein derived from the thermophilic methanogenic archaeon Methanothermobacter marburgensis. This subunit is a critical component of the Eha hydrogenase complex, a group 3 [NiFe]-hydrogenase involved in energy conservation and methanogenesis . The recombinant form is expressed in Escherichia coli with an N-terminal His-tag for purification and structural/functional studies .

ehaA’s Specific Role:

  • Membrane Integration: ehaA is a hydrophobic transmembrane subunit, likely facilitating proton translocation across the membrane .

  • Subunit Coordination: Interacts with soluble subunits (e.g., EhaE, EhaC) containing [NiFe] and [4Fe-4S] clusters for H₂ oxidation and electron transfer .

Comparative Analysis with Ehb Hydrogenase

FeatureEha ComplexEhb Hydrogenase
Primary FunctionEnergy conservation via H₂ oxidationCarbon assimilation and redox regulation
SubstrateH₂ → Low-potential ferredoxinsH₂ → Ferredoxins for biosynthesis
Genomic OrganizationLarge operon (12.5 kb, 20 ORFs)Smaller operon (9.6 kb, 17 ORFs)
Growth DependencyEssential for methanogenesis in minimal mediaAuxotrophy observed in mutants

Source:

Metabolic Roles

  • Energy Conservation: Eha generates reduced ferredoxins (e.g., Fdᵣᵉᵈ) by oxidizing H₂, utilizing the proton gradient to drive ATP synthesis .

  • Carbon Assimilation: Mutants lacking Eha exhibit impaired growth in minimal media, requiring supplements like acetate, indicating a role in CO₂ fixation .

  • Electron Bifurcation: In M. marburgensis, Eha may participate in electron bifurcation (FBEB), a mechanism allowing simultaneous reduction of high- and low-potential electron carriers .

Applications and Research Tools

  • Biochemical Research: Recombinant ehaA is used to study hydrogenase activity, proton translocation, and interactions with ferredoxins .

  • ELISA and Antibody Development: Commercially available ehaA protein is employed in immunoassays to detect hydrogenase subunits in methanogenic communities .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ehaA; MTBMA_c07840; Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg) (Methanobacterium thermoautotrophicum)
Target Names
ehaA
Target Protein Sequence
MIIHVTYLSGYITGIISSIIISAILGLPLAPERPARHSWTPSAIFPAPIIAMGLVAICIK LGVTGMYGGVDLGVVSGLLAALMTAYFLEDIFPRPEDL
Uniprot No.

Target Background

Function
One of the integral membrane subunits of multisubunit membrane-bound [NiFe]-hydrogenase eha. Eha is predicted to form a large electron transfer complex and might catalyze energy-driven reduction of low-potential redox carriers (Potential).
Database Links
Protein Families
EhaA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Eha complex in Methanothermobacter marburgensis and what role does the ehaA subunit play?

The Eha (energy-converting hydrogenase A) complex is a multisubunit membrane-bound [NiFe] hydrogenase found in methanogenic archaea, including M. marburgensis. It catalyzes the reversible reduction of ferredoxin using H₂ as an electron donor. The ehaA subunit specifically functions as one of the critical membrane components of this complex, contributing to the proton translocation machinery that couples electron transfer to energy conservation. This hydrogenase belongs to a distinct group of multisubunit membrane-bound [NiFe] hydrogenases that show high sequence similarity to energy-conserving NADH:quinone oxidoreductase (complex I) found in various organisms .

How is the eha operon genetically organized in Methanothermobacter species?

In Methanothermobacter species, the eha operon spans approximately 12.5 kb and contains 20 open reading frames. These encode the large [NiFe] hydrogenase subunit, a small [NiFe] hydrogenase subunit, two conserved integral membrane proteins, a 6[4Fe-4S] polyferredoxin, a 10[4Fe-4S] polyferredoxin, four non-conserved hydrophilic subunits, and ten non-conserved integral membrane proteins. The membrane subunit A (ehaA) is one of these integral membrane components. The operon's organization enables coordinated expression of all components necessary for the assembly and function of the complete Eha complex .

What experimental approaches are typically used to express and purify recombinant ehaA?

Heterologous expression in E. coli systems using specialized plasmids containing inducible promoters is a common approach for producing recombinant ehaA. The methodology typically follows these steps:

  • Gene amplification from M. marburgensis genomic DNA using specific primers

  • Cloning into expression vectors with appropriate affinity tags (His-tag, GST-tag)

  • Transformation into E. coli expression strains optimized for membrane proteins

  • Induction of protein expression under controlled conditions (temperature, IPTG concentration)

  • Membrane fraction isolation by ultracentrifugation following cell lysis

  • Solubilization of membrane proteins using mild detergents (DDM, LDAO)

  • Purification by affinity chromatography and size exclusion chromatography

This methodological approach requires careful optimization of each step to maintain protein stability and functional integrity .

How can experimental design approaches be optimized when studying the function of recombinant ehaA in vitro?

When designing experiments to study recombinant ehaA function, researchers should implement a structured experimental design approach with appropriate controls. Start by establishing a testable hypothesis regarding ehaA's specific role in electron transfer or proton translocation. Setup independent variables (pH, temperature, substrate concentrations) and dependent variables (hydrogenase activity, proton translocation efficiency) with precise measurements for quantitative analysis .

For functional reconstitution studies, consider:

  • Lipid composition of proteoliposomes (mimicking archaeal membranes)

  • Redox potential control systems using appropriate buffers

  • Ion gradient formation monitoring using pH-sensitive fluorophores

  • Real-time H₂ consumption/production measurements

  • Controls using site-directed mutagenesis variants for key residues

Statistical analysis should employ appropriate methods to distinguish between experimental conditions, and researchers should consider potential confounding variables such as protein stability in different detergents or lipid environments .

What are the proposed mechanisms for coupling electron transfer to proton translocation in the Eha complex, and how can these be experimentally verified?

The Eha complex likely couples electron transfer from H₂ to ferredoxin with proton translocation across the membrane through a conformational change mechanism. This process is proposed to function as follows:

  • H₂ oxidation at the [NiFe] active site in the catalytic subunit

  • Electron transfer through iron-sulfur clusters to ferredoxin

  • Energy released during electron transfer drives conformational changes in the membrane subunits

  • These conformational changes facilitate proton translocation against a concentration gradient

To experimentally verify this mechanism, implement:

  • Site-directed mutagenesis targeting conserved residues in proton channels

  • Proton pumping assays using pH-sensitive fluorophores in reconstituted proteoliposomes

  • Structural studies (cryo-EM) to capture different conformational states

  • Hydrogen-deuterium exchange mass spectrometry to identify dynamic protein regions

  • Comparative analysis with related hydrogenases (Ehb, Ech) to identify conserved mechanistic features

How does the regulation of eha gene expression respond to hydrogen availability, and what experimental approaches best quantify these changes?

The expression of eha genes is regulated in response to hydrogen availability, with transcript levels approximately threefold higher under hydrogen limitation compared to hydrogen-sufficient conditions. This regulation suggests a critical role in energy conservation under nutrient-limited conditions. To quantify these expression changes, researchers should employ:

  • Competitive RT-PCR comparing eha transcript abundance to constitutively expressed genes

  • RNA-Seq analysis under varying hydrogen concentrations

  • Quantitative proteomics to correlate transcript levels with protein abundance

  • Reporter gene assays to identify regulatory elements in the eha promoter region

  • DNA-protein interaction studies to identify transcription factors involved in hydrogen-responsive regulation

These approaches should be conducted in a true experimental design framework with controlled independent variables (H₂ partial pressure) and precisely measured dependent variables (transcript abundance, protein levels) .

What experimental controls are essential when characterizing recombinant ehaA activity?

When characterizing recombinant ehaA activity, implement multiple controls to ensure experimental validity:

  • Negative controls:

    • Empty vector-transformed cells processed identically

    • Heat-inactivated protein preparations

    • Proteoliposomes without reconstituted protein

  • Positive controls:

    • Well-characterized related membrane proteins (if available)

    • Native Eha complex isolated from M. marburgensis

    • Synthetic proton gradient controls for transport assays

  • Method validation controls:

    • Standard curves for all quantitative measurements

    • Internal standards for normalization between experiments

    • Technical and biological replicates (minimum n=3)

These controls help distinguish between true activity and experimental artifacts while establishing the reliability and reproducibility of your findings in accordance with rigorous experimental design principles .

How can researchers differentiate between the functions of Eha and Ehb hydrogenases in Methanothermobacter species?

Differentiating between Eha and Ehb functions requires careful experimental design that isolates the specific activities of each complex:

ApproachMethodologyExpected Outcome
Genetic deletionCreate Δeha and Δehb mutantsPhenotypic analysis reveals specific growth defects
Biochemical assaysPurify individual complexesDirect measurement of substrate specificity and kinetics
Expression analysisRT-PCR under varying conditionsDifferent expression patterns suggest distinct roles
Protein-protein interactionCo-immunoprecipitationIdentification of complex-specific interaction partners
Structural studiesCryo-EM of purified complexesStructural differences suggesting functional specialization

While Eha and Ehb are both membrane-bound [NiFe] hydrogenases with similar subunit composition, they likely have distinct physiological roles. Eha may be more involved in CO₂ reduction to formylmethanofuran, while Ehb may participate more in anaplerotic reactions or biosynthetic pathways. Comparative analysis of their biochemical properties and expression patterns under various growth conditions can help elucidate their specific functions .

How do Eha complexes from different methanogenic archaea compare structurally and functionally?

Comparison of Eha complexes across methanogenic archaea reveals important structural and functional conservation patterns:

SpeciesOperon SizeNumber of SubunitsDistinct FeaturesPrimary Function
M. marburgensis~12.5 kb206[4Fe-4S] and 10[4Fe-4S] polyferredoxinsCO₂ reduction to CHO-MFR
M. thermoautotrophicum12.5 kb20Similar to M. marburgensisCO₂ reduction coupled to ion transport
M. barkeriVariableFewer subunitsContains Ech rather than EhaAcetate metabolism and biosynthesis

The Eha complex in strictly hydrogenotrophic methanogens like M. marburgensis shows adaptations for efficient coupling of H₂ oxidation to CO₂ reduction, while related complexes in metabolically versatile methanogens (M. barkeri) may be more specialized for anabolic functions. These differences reflect adaptation to specific ecological niches and metabolic capabilities .

What is the relationship between Eha hydrogenases and the flavin-based electron bifurcation systems in methanogenic archaea?

Eha hydrogenases and flavin-based electron bifurcation (FBEB) systems represent complementary energy conservation strategies in methanogenic archaea:

  • Eha hydrogenases:

    • Membrane-bound complexes that couple ferredoxin reduction to ion translocation

    • Generate low-potential electrons for CO₂ reduction using membrane potential

    • Primary function in energy conservation during hydrogenotrophic methanogenesis

  • FBEB systems (e.g., MvhAGD:HdrABC):

    • Soluble complexes that couple exergonic and endergonic electron transfers

    • Use bifurcating FAD cofactors to generate low-potential electrons

    • Function in energy conservation during heterodisulfide reduction

In M. marburgensis, these systems operate in concert, with FBEB systems like MvhAGD:HdrABC coupling the exergonic reduction of heterodisulfide (CoM-S-S-CoB) to the endergonic reduction of ferredoxin. The reduced ferredoxin can then be used for biosynthetic reactions or feed into membrane-bound complexes like Eha for additional energy conservation .

What technical challenges remain in studying the structure and function of complete Eha complexes?

Several significant technical challenges hinder comprehensive structural and functional characterization of the complete Eha complex:

  • Membrane protein expression and stability:

    • Difficulty in heterologous expression of complete 20-subunit complexes

    • Maintaining structural integrity during purification

  • Functional reconstitution:

    • Creating artificial membranes mimicking archaeal lipid composition

    • Measuring coupled reactions (H₂ oxidation, ferredoxin reduction, ion translocation) simultaneously

  • Structural analysis:

    • Size and complexity of the full complex complicates cryo-EM studies

    • Conformational heterogeneity during the catalytic cycle

  • Physiological relevance:

    • Connecting in vitro activity measurements to in vivo function

    • Accounting for interactions with other cellular components

Addressing these challenges requires interdisciplinary approaches combining advanced membrane protein biochemistry, biophysics, and systems biology perspectives. Development of archaeal genetic systems for Methanothermobacter would significantly advance this field .

How might understanding Eha complex function contribute to biotechnological applications in hydrogen metabolism?

Understanding the Eha complex offers several promising biotechnological applications:

  • Biohydrogen production:

    • Engineered systems incorporating Eha components could harness the bidirectional hydrogen metabolism for hydrogen production

    • Optimization of electron transfer chains for improved efficiency

  • Biofuel cells:

    • Exploitation of the directional proton pumping capacity for bioelectrochemical systems

    • Development of hydrogen-based biocatalytic energy conversion

  • CO₂ fixation technologies:

    • Utilization of the CO₂ reduction capacity for carbon capture applications

    • Integration with other biological CO₂ fixation pathways

  • Synthetic biology platforms:

    • Creation of minimal artificial systems for hydrogen metabolism

    • Engineering of hybrid energy conservation systems combining features of different hydrogenases

These applications require detailed understanding of the structure-function relationships in Eha and related complexes, particularly the mechanisms coupling electron transfer to ion translocation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.