Recombinant Methanothermobacter thermautotrophicus Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Recombinant Methanothermobacter thermautotrophicus Protease HtpX homolog (htpX) is a genetically engineered version of the HtpX protease derived from the hyperthermophilic archaeon Methanothermobacter thermautotrophicus strain ΔH. This enzyme belongs to the Peptidase M48B family (EC 3.4.24.-) and is annotated as a membrane-bound metalloprotease involved in protein quality control under stress conditions . The recombinant protein is expressed in heterologous systems for research applications, with a full-length sequence spanning 258 amino acids (UniProt ID: O26669) .

Key Features

PropertyDetails
Gene LocusMTH_569
Molecular Weight~27.1 kDa (theoretical)
Subcellular LocationCell membrane; multi-pass membrane protein
Conserved DomainsN-terminal helix-turn-helix (HTH) motif; C-terminal protease domain
Recombinant ExpressionProduced with species-specific tags (determined during production)

Sequence and Domain Architecture

The HtpX protein sequence begins with the amino acid residues MEEKAKMRRLSTWKLKLRMFLATVLLFGLIYAILMVVGSILGLGGPLFYALLGFGVIFLQ... and includes:

  • N-terminal HTH motif (positions 28–52): Critical for DNA binding and regulatory functions, as observed in homologous archaeal heat shock regulators like HSR1 in Archaeoglobus fulgidus .

  • C-terminal protease domain: Exhibits lower sequence conservation but shares structural similarities with bacterial metalloproteases involved in stress response .

Functional Role in M. thermautotrophicus

HtpX is implicated in protein degradation during thermal stress. Comparative proteomic studies revealed:

  • Temperature Stress Response: HtpX expression is upregulated under both high-temperature (71°C) and cold-shock (4°C) conditions, alongside increased protein folding and degradation machinery .

  • Methanogenesis Link: Downregulation of HtpX correlates with reduced methane production during temperature stress, suggesting a role in maintaining cellular homeostasis .

  • ELISA Kits: Recombinant HtpX is marketed for immunoassays (e.g., CSB-CF517928MSR), enabling detection of archaeal stress response mechanisms .

  • Structural Studies: Used to investigate HtpX’s role in archaeal thermostability and membrane protein dynamics.

Proteomic Studies

  • Temperature Adaptation: HtpX is part of a cohort of stress-responsive proteins (e.g., chaperones, proteasome subunits) that stabilize M. thermautotrophicus under thermal fluctuations .

  • Gene Clustering: The htpX gene (MTH_569) is genomically linked to operons encoding ribosomal proteins and metabolic enzymes, suggesting co-regulation under stress .

Unexplored Mechanisms

  • Regulatory Pathways: The absence of a conserved palindromic binding motif (CTAAC-N5-GTTAG) in M. thermautotrophicus promoters implies HtpX regulation differs from homologs like A. fulgidus HSR1 .

  • Interaction Networks: Potential crosstalk with proteasome subunits (e.g., differential acetylation observed in syntrophic cultures) warrants further study .

Future Directions

  • Structural Resolution: Cryo-EM or X-ray crystallography to map HtpX’s membrane interaction sites.

  • Genetic Knockout Models: Elucidate HtpX’s contribution to methanogen survival in extreme environments .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipment is preferred, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag based on your request.
Synonyms
htpX; MTH_569; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)
Target Names
htpX
Target Protein Sequence
MEEKAKMRRLSTWKLKLRMFLATVLLFGLIYAILMVVGSILGLGGPLFYALLGFGVIFLQ YLISPKIVELTMNVHYVSEAEAPRLHAMVDELARRAGIPKPMVGIAEIALPNAFAFGRTK ADGRVCVTRGILNLLDEEELRAVLGHEISHIKHSDMIVMTLVSAVPLICYYIFWSTVFSR DDEANLVGIAALIAYFIGQLIVLFISRTREYYADQGSVEIGGQPHKLASALYKLVLRLSP VQQGRPETGRGCQGLLPE
Uniprot No.

Target Background

Database Links

KEGG: mth:MTH_569

STRING: 187420.MTH569

Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How Does HtpX Function in Protein Quality Control Systems?

HtpX functions as part of the membrane-localized proteolytic system involved in the quality control of membrane proteins. Studies in E. coli have established that HtpX participates in the degradation of misfolded or unassembled membrane proteins, working in conjunction with other proteases such as FtsH .

The protease exhibits both self-cleavage activity and the ability to degrade substrate proteins when supplemented with Zn²⁺. In E. coli, HtpX has been shown to cleave the membrane protein SecY both in vitro and in vivo . This suggests that M. thermautotrophicus HtpX likely performs similar functions in archaeal cells, contributing to membrane protein homeostasis under normal and stress conditions.

Research indicates that HtpX is particularly important under temperature stress conditions. In Archaeoglobus fulgidus, a related archaeon, HtpX expression is induced approximately two-fold after 30 minutes of heat shock . This upregulation suggests a role in degrading damaged proteins that accumulate during thermal stress, which is particularly relevant for thermophilic organisms like M. thermautotrophicus that must maintain protein homeostasis at elevated temperatures .

What Experimental Systems Have Been Developed to Study HtpX Activity?

Researchers have developed several experimental approaches to study HtpX activity:

In vitro Biochemical Characterization:

For E. coli HtpX, researchers have established protocols for purification under denaturing conditions followed by refolding in the presence of zinc chelators. The purified enzyme exhibits self-cleavage activity when supplemented with Zn²⁺ and can degrade model substrates like casein .

In vivo Protease Activity Assays:

A semiquantitative and convenient in vivo protease activity assay system has been developed for E. coli HtpX using a model substrate. This system enables detection of differential protease activities of wild-type and mutant HtpX proteins . The assay involves:

  • Construction of a model substrate (designated as XMS1)

  • Co-expression of HtpX and the substrate in E. coli

  • Detection of proteolytic processing via western blotting

  • Quantification of cleavage products (CL-N and CL-C fragments)

Similar approaches could be adapted for studying M. thermautotrophicus HtpX, though modifications would be required to account for the thermophilic nature of this enzyme.

How Does Temperature Affect HtpX Expression and Activity in M. thermautotrophicus?

M. thermautotrophicus is a thermophilic archaeon with an optimal growth temperature of 65°C (range: 40-75°C) . Proteomic analyses have revealed significant changes in protein expression patterns under different temperature conditions:

Temperature Response Data:

Comparative proteomic analysis using iTRAQ showed that M. thermautotrophicus responds differently to high temperature growth (71°C) and cold shock (4°C) conditions . Key findings include:

  • Different sets of proteins are uniquely expressed under high temperature versus cold shock conditions

  • Some proteins show shared responses to both temperature extremes

  • Proteins involved in processing environmental information and cell membrane/wall/envelope biogenesis play key roles in the temperature stress response

The following table summarizes the functional groups showing differential expression under temperature stress:

Response PatternFunctional Groups (COG terms)Biological Significance
Different between high and low temperatureI, M, P, TDistinct regulatory mechanisms for different temperature stresses
Similar between high and low temperatureD, C, H, J, LCommon compatible mechanisms to cope with temperature stress

While the search results don't specifically detail HtpX expression changes in M. thermautotrophicus under temperature stress, studies in related archaea like Archaeoglobus fulgidus show that HtpX is induced approximately 2-fold after 30 minutes of heat shock , suggesting a similar role in M. thermautotrophicus.

What is the Role of Metal Ions in HtpX Structure and Function?

HtpX is a zinc-dependent metalloprotease, and metal ions play crucial roles in its structure and function. Recent 3D structural analysis of a related HtpX protease (DX-3-htpX) provides insights into metal ion interactions:

Metal Ion Binding Pockets:

Analysis using CASTpFold revealed that various metal ions can bind to HtpX, altering its 3D structure and active sites . The data show:

Protease FormActive Pocket Area (Ų)Active Pocket Volume (ų)Effect
HtpX alone557.472837.241Baseline structure
HtpX-Ca²⁺918.1541378.221Largest active pocket
HtpX-Cl⁻714.286867.364Moderate enlargement
HtpX-K⁺925.5441335.237Significant enlargement
HtpX-Zn²⁺811.0231179.127Substantial enlargement

This data indicates that metal ion binding, particularly Ca²⁺ binding, can significantly alter the active site geometry of HtpX, potentially affecting substrate recognition and catalytic efficiency .

For M. thermautotrophicus HtpX specifically, the zinc-binding motif (HEXXH) is critical for coordinating the catalytic zinc ion. Based on studies of E. coli HtpX, the enzyme likely requires zinc supplementation for proteolytic activity, and purification protocols typically involve refolding in the presence of zinc chelators followed by zinc addition to restore activity .

How Does HtpX Compare Across Different Archaeal and Bacterial Species?

HtpX is widely conserved across both bacterial and archaeal domains, suggesting its fundamental importance in cellular proteostasis. Comparative analyses reveal both conservation and divergence:

Orthology Analysis:

InParanoidB analysis shows that M. thermautotrophicus HtpX (UniProt: O26669) forms ortholog groups with multiple bacterial and archaeal HtpX proteins . For example:

Group IDSpeciesProteinBitscoreRelationship
377Sphaerobacter thermophilusD1C2Q3176Ortholog
486Leptospira interrogansQ8EXN4114Ortholog
354Dethiosulfatarculus sandiegensisA0A0D2GC86290Ortholog

The conservation of HtpX across diverse species, including thermophiles, suggests a critical role in protein quality control mechanisms that has been maintained throughout evolution.

Functional Conservation:

Studies in E. coli have characterized HtpX as a membrane-bound zinc metalloprotease involved in protein quality control . Similar functions have been observed in archaea, including Archaeoglobus fulgidus where HtpX is upregulated during heat shock . This functional conservation suggests that despite sequence divergence, the core role of HtpX in proteolytic quality control is maintained across domains of life.

What Purification and Characterization Protocols Are Most Effective for Recombinant HtpX?

Based on studies of related proteases, the following methodological approach is recommended for recombinant HtpX:

Expression System:

Recombinant expression can be performed in E. coli or B. subtilis expression systems. For the related DX-3-htpX protease, researchers successfully used the following approach:

  • Primer design with appropriate restriction sites (BamHI and SmaI)

  • PCR amplification of the htpX gene

  • Cloning into pHT43 expression vector

  • Transformation into E. coli DH5α for validation

  • Transformation into E. coli BL21(DE3) for improved efficiency

  • Final electro-transformation into B. subtilis WB800N

Purification Strategy:

For E. coli HtpX, which undergoes self-degradation upon cell disruption or membrane solubilization, the following purification strategy has been effective:

  • Purification under denaturing conditions

  • Refolding in the presence of a zinc chelator

  • Zinc supplementation to restore proteolytic activity

For M. thermautotrophicus HtpX, storage recommendations include:

  • Storage buffer: Tris-based buffer with 50% glycerol

  • Storage temperature: -20°C (or -80°C for extended storage)

  • Working aliquots: Store at 4°C for up to one week

  • Avoid repeated freezing and thawing

Characterization Methods:

For functional characterization, researchers can assess:

  • Self-cleavage activity in the presence of zinc

  • Proteolytic activity against model substrates (e.g., casein)

  • Cleavage of membrane protein substrates (e.g., SecY)

  • Temperature-dependent activity profile (critical for thermophilic enzymes)

How Does HtpX Activity Relate to Methanogenesis in M. thermautotrophicus?

While direct evidence linking HtpX to methanogenesis is limited, proteomic analyses provide insights into potential relationships:

Comparative proteomic studies of M. thermautotrophicus under different growth conditions reveal that protein degradation pathways are affected during temperature stress, which coincides with decreased methane formation . This suggests that proteases like HtpX may indirectly influence methanogenesis by:

  • Controlling turnover of methane-producing enzymes

  • Contributing to proteostasis during environmental stress

  • Participating in quality control of membrane proteins involved in energy conservation

In syntrophic coculture with butyrate-oxidizing bacteria, M. thermautotrophicus shows different protein expression patterns compared to pure culture growth conditions. Notably, proteasome subunits are differentially acetylated between these conditions, suggesting controlled protein turnover rates under syntrophic growth . Although HtpX is not specifically mentioned in this context, as a protease involved in protein quality control, it may contribute to the proteolytic regulation observed under different growth conditions.

What Are the Biotechnological Applications of Recombinant HtpX?

As a thermostable protease from a hyperthermophilic archaeon, recombinant M. thermautotrophicus HtpX offers several potential biotechnological applications:

Enzyme Characteristics Relevant for Applications:

The DX-3-htpX protease, which shares functional characteristics with M. thermautotrophicus HtpX, demonstrates:

  • Optimal reaction temperature of 45°C

  • Strong temperature tolerance (>90% activity retention at 50°C for 8h)

  • Optimal pH of 7 with activity across pH 7-9

  • Resistance to both acidic and alkaline conditions

These characteristics make thermostable proteases valuable for various applications requiring enzymatic activity at elevated temperatures or under harsh conditions.

Research Applications:

  • Model system for studying protein quality control mechanisms in extremophiles

  • Tool for investigating membrane protein dynamics under stress conditions

  • Component in synthetic biology approaches for thermophilic systems

What Future Research Directions Are Most Promising for HtpX Studies?

Based on current knowledge gaps, several promising research directions emerge:

  • Structural Biology: Determine the high-resolution structure of M. thermautotrophicus HtpX to understand the molecular basis of its thermostability and substrate recognition.

  • Substrate Identification: Identify the physiological substrates of HtpX in M. thermautotrophicus using proteomic approaches such as SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or proximity labeling techniques.

  • Regulon Analysis: Investigate the regulatory networks controlling HtpX expression, particularly in response to different stressors (temperature, salt, pH).

  • Engineering Studies: Explore protein engineering of HtpX to enhance its thermostability, substrate specificity, or catalytic efficiency for biotechnological applications.

  • Comparative Proteostasis: Conduct comparative studies of protein quality control systems across thermophilic, mesophilic, and psychrophilic organisms to understand adaptations of proteases like HtpX to different thermal environments.

  • Synthetic Biology Applications: Develop synthetic biology tools incorporating HtpX for controlled protein degradation in thermophilic expression systems.

These research directions could significantly advance our understanding of archaeal proteases and their roles in extremophilic adaptations, while potentially yielding valuable biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.