Recombinant Methanothermobacter thermautotrophicus Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Introduction to Methanothermobacter thermautotrophicus

Methanothermobacter thermautotrophicus (formerly known as Methanobacterium thermoautotrophicum) is a thermophilic archaeon that has been extensively studied for its unique metabolic capabilities and adaptations to extreme environments . This organism is commonly found in anaerobic sewage sludge and anoxic freshwater sediments, where it contributes to methane production through methanogenesis . The strain most frequently used in research is designated as Delta H (ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330), which has been fully sequenced and characterized .

M. thermautotrophicus possesses several distinctive features that make it an important model organism for studying archaeal biology. The genome of M. thermautotrophicus encodes numerous proteins involved in various cellular processes, including protein secretion and membrane transport mechanisms . Among these, the Sec protein export system stands out as a critical pathway for protein translocation across cellular membranes, playing an essential role in the organism's physiology and survival in extreme environments.

Genomic Context and Protein Secretion in M. thermautotrophicus

The genome of M. thermautotrophicus contains a complete set of genes coding for the Sec protein export system . Unlike some other archaeal species, M. thermautotrophicus lacks the Twin Arginine Translocation (Tat) system, which is typically involved in the export of proteins with prosthetic groups . This absence of the Tat system appears to be a common characteristic among methanogens lacking cytochromes, suggesting that the Sec pathway serves as the primary mechanism for protein export in these organisms .

Approximately 330 out of 1607 coding sequences (CDS) in M. thermautotrophicus are predicted to form at least one transmembrane helix, indicating their location in the cytoplasmic membrane . Most other CDS appear to encode cytoplasmic proteins, with very few predicted to have a "periplasmic" location . This distribution underscores the importance of membrane transport systems like the Sec pathway in maintaining cellular homeostasis and facilitating interactions with the external environment.

General Principles of Protein Translocation

The Sec translocon is an evolutionarily conserved multiprotein complex that facilitates the biogenesis of both secretory and membrane proteins across diverse domains of life . In bacteria such as Escherichia coli, this system has been extensively characterized and serves as a model for understanding similar mechanisms in archaea . The Sec translocon functions by translocating proteins across the cytoplasmic membrane in an unfolded state, allowing them to fold properly in their final destination compartment .

Targeting of proteins to the Sec translocon is facilitated by N-terminal signal peptides, which direct the nascent proteins to the translocation machinery . Depending on the specific signal peptide, proteins can be routed through either the cotranslational signal recognition particle (SRP)-dependent pathway or the posttranslational SecA/SecB-dependent pathway . Upon successful translocation, the signal peptide is cleaved off by leader peptidase, resulting in the mature, functional protein .

The Sec System in M. thermautotrophicus

M. thermautotrophicus possesses a complete Sec protein export system, which includes various components necessary for efficient protein translocation . This system plays a crucial role in the organism's cellular physiology, facilitating the proper localization of proteins to their intended destinations. Unlike in some other organisms, the Sec system in M. thermautotrophicus likely represents the predominant pathway for protein export, given the absence of alternative translocation systems such as the Tat pathway .

The core components of the Sec translocon in M. thermautotrophicus include SecY and SecE, which form the central channel through which proteins are transported . Additional components like SecD contribute to the efficiency and regulation of this process, ensuring that proteins are properly translocated across the membrane barrier . The coordinated action of these components is essential for maintaining cellular function and adapting to environmental changes.

Functional Role in Protein Translocation

SecD plays a critical role in the later stages of protein translocation across the cytoplasmic membrane. While the exact mechanism of SecD function in M. thermautotrophicus has not been fully elucidated, insights from bacterial homologs suggest that it contributes to the release of translocated proteins from the Sec machinery and may also be involved in maintaining the proton motive force necessary for efficient translocation .

In bacterial systems, SecD forms a complex with SecF, and this SecDF complex is known to enhance the efficiency of protein export by preventing backward movement of partially translocated proteins . Although the specific interactions of M. thermautotrophicus SecD with other components of the Sec system remain to be fully characterized, it is likely that similar functional principles apply in this archaeal context.

Expression and Purification

Recombinant M. thermautotrophicus Protein translocase subunit SecD is produced using molecular cloning and heterologous expression techniques . The protein is typically expressed with a tag to facilitate purification, although the specific tag type may vary depending on the production process . Commercial preparations of the recombinant protein are available in quantities of 50 μg or other amounts as needed for research purposes .

Proper storage of the recombinant protein is essential for maintaining its stability and functional integrity. The recommended storage conditions include keeping the protein in a Tris-based buffer with 50% glycerol at -20°C for regular use, or at -20°C to -80°C for extended storage . Repeated freezing and thawing should be avoided to prevent protein degradation, and working aliquots can be stored at 4°C for up to one week .

Physical and Biochemical Properties

The recombinant SecD protein from M. thermautotrophicus exhibits several notable physical and biochemical properties that reflect its native function in the cell. The protein has a molecular weight consistent with its amino acid composition and may contain post-translational modifications depending on the expression system used . As a membrane protein, SecD likely exhibits hydrophobic characteristics that facilitate its integration into lipid bilayers.

Table 1: Key Properties of Recombinant M. thermautotrophicus SecD Protein

PropertyDescription
Species OriginMethanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Gene NamesecD
Locus NameMTH_849
UniProt AccessionO26937
Expression Region1-403
Storage BufferTris-based buffer, 50% glycerol, optimized for protein stability
Storage Conditions-20°C for regular use; -20°C to -80°C for extended storage
Recommended Working ConditionsStore working aliquots at 4°C for up to one week

Studying Archaeal Protein Translocation

Recombinant M. thermautotrophicus SecD serves as a valuable tool for investigating protein translocation mechanisms in archaea . By studying the properties and interactions of this protein, researchers can gain insights into the similarities and differences between archaeal and bacterial protein export systems, contributing to our understanding of evolutionary relationships across domains of life.

The availability of purified recombinant SecD enables various biochemical and biophysical studies, including protein-protein interaction analyses, structural investigations, and functional assays . These approaches help elucidate the precise role of SecD in the archaeal Sec translocon and its contribution to protein transport across membranes under thermophilic conditions.

Implications for Biotechnology

Understanding the mechanisms of protein translocation in thermophilic archaea like M. thermautotrophicus has potential applications in biotechnology, particularly in the development of improved systems for recombinant protein production . The insights gained from studying the archaeal Sec system, including the role of SecD, could inform strategies for enhancing protein secretion in industrial production hosts.

The thermostable nature of proteins from M. thermautotrophicus, including components of the Sec system, makes them potentially valuable for applications requiring stability at elevated temperatures . Investigations into the structural and functional properties of SecD may reveal features that contribute to thermostability, which could be applied in protein engineering efforts aimed at creating heat-resistant variants of industrial enzymes.

Comparison with Bacterial Sec Systems

While the archaeal and bacterial Sec systems share fundamental principles of operation, there are notable differences in composition and regulation. In bacteria like E. coli, the Sec translocon consists of the SecYEG complex as the core channel, with accessory components including SecA, SecB, and the SecDF complex . The archaeal Sec system in M. thermautotrophicus appears to contain homologs of several of these components, including SecD, but may differ in terms of specific protein-protein interactions and regulatory mechanisms .

Research on the E. coli Sec system has shown that the production of recombinant secretory proteins can lead to saturation of the Sec translocon capacity, resulting in impaired protein translocation and decreased biomass formation . The consequences depend on whether the proteins are targeted cotranslationally or posttranslationally to the Sec translocon . Similar phenomena may occur in archaeal systems, although the specific effects of recombinant protein production on M. thermautotrophicus SecD function remain to be investigated.

Unique Features of the M. thermautotrophicus Sec System

The Sec system in M. thermautotrophicus exhibits several unique features that distinguish it from its counterparts in other organisms. Unlike many bacteria, which possess both the Sec and Tat pathways for protein export, M. thermautotrophicus relies primarily on the Sec system due to the absence of a functional Tat pathway . This specialization may reflect adaptations to the thermophilic lifestyle and metabolic requirements of this archaeon.

Another distinctive aspect of the M. thermautotrophicus Sec system is its operation in the context of an archaeal cell envelope structure, which differs from both bacterial and eukaryotic systems . The archaeal cytoplasmic membrane typically contains ether-linked lipids rather than the ester-linked lipids found in bacteria, potentially influencing the interactions between membrane-embedded components like SecD and their lipid environment .

Recent Advances

Recent research on archaeal protein translocation systems has expanded our understanding of the structural and functional properties of components like SecD. Advances in structural biology techniques, including cryo-electron microscopy and X-ray crystallography, have enabled more detailed investigations of protein complexes involved in membrane transport . These approaches could provide valuable insights into the three-dimensional structure of M. thermautotrophicus SecD and its interactions with other components of the Sec translocon.

Proteomics studies have also contributed to our knowledge of archaeal protein secretion, revealing patterns of protein expression and localization under different environmental conditions . Such analyses help identify the substrates of the Sec system in M. thermautotrophicus and elucidate the role of SecD in facilitating their translocation across the membrane.

Future Research Opportunities

Several avenues for future research on M. thermautotrophicus SecD present themselves. One promising direction involves detailed mechanistic studies to determine how SecD contributes to the efficiency of protein translocation, potentially through interactions with other components of the Sec machinery or by facilitating the release of translocated proteins from the translocation channel .

Another important area for investigation concerns the regulation of secD gene expression and SecD protein activity in response to environmental changes or cellular stress . Understanding these regulatory mechanisms could provide insights into how M. thermautotrophicus adapts its protein secretion capacity to different growth conditions and challenges.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
secD; MTH_849; Protein-export membrane protein SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-403
Protein Length
full length protein
Species
Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)
Target Names
secD
Target Protein Sequence
MNRKVSKFLKDYRVILLIVLVAASITAISTMGIQQGLDLQGGSLIQIQLERPVDAATMNT VTSVLDKRLNIFGVKDVKVRASGDQNVIVEIAGVQPDQVADIVGKPGKFEAKIGNETVLT GTDIVSVQPPIITGNEWEVPFRLSTDGARKFAEAARGKAGEPVKMYLDDRLITAPEISAE VATGKPVTDVRITGAENSKAEAEVQAKEIETLLKSGSLPVKVKIVGVSSVSPELGKQFAE GAVIAGLLAVLAIAVILIVRYRSPILVLPIFFTTLAELLLILGAAAVIRWNIDLAAIAGI LAAIGTGVDDQIIITDEVLSGEGRRTRRKFRIKDAFFIIFASAGTLIAAMLPLAYIGFSR GATGIGLLAGFAFTTVLGVIIGVFITRPVYARFIETFNVAGRK
Uniprot No.

Target Background

Function
Plays a crucial role in protein export.
Database Links

KEGG: mth:MTH_849

STRING: 187420.MTH849

Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of SecD in protein translocation?

SecD is an integral membrane protein that forms a sub-complex with SecF and YajC, which associates with the core SecYEG complex that constitutes the protein-conducting channel. This sub-complex significantly enhances the fidelity of protein secretion across the membrane. While SecD itself is not essential for viability under laboratory conditions, it contributes to the efficiency of protein translocation by preventing backward sliding of translocating polypeptides and may participate in late stages of protein secretion .

How does SecD in M. thermautotrophicus compare to other archaeal and bacterial homologs?

M. thermautotrophicus SecD shares structural homology with bacterial counterparts but has evolved specific adaptations for functioning at high temperatures (55-65°C) characteristic of this thermophilic archaeon. While the core function remains conserved across domains of life, sequence analysis reveals thermostability-conferring features including increased hydrophobic interactions, additional salt bridges, and a higher proportion of charged amino acids at the protein surface . Comparative analysis with mesophilic homologs shows sequence conservation in the transmembrane domains but greater divergence in periplasmic domains.

What is known about the structural organization of the SecD-SecF-YajC subcomplex?

The SecD-SecF-YajC subcomplex in M. thermautotrophicus consists of membrane-spanning domains that anchor the complex in the lipid bilayer and periplasmic domains that extend into the extracellular space. This arrangement allows the complex to interact with both the SecYEG channel and the translocating polypeptide. Structural studies suggest that SecD undergoes conformational changes during protein translocation, powered by the proton motive force rather than ATP hydrolysis, which distinguishes its mechanism from that of the SecA motor protein .

What genetic tools are available for studying SecD in M. thermautotrophicus?

Recent developments have established a genetic system for M. thermautotrophicus ΔH using shuttle vectors that can replicate in both Escherichia coli and M. thermautotrophicus. These vectors utilize the cryptic plasmid pME2001 from Methanothermobacter marburgensis as the replicon and a thermostable neomycin resistance cassette as the selectable marker . This shuttle-vector system enables the expression of heterologous genes and can be adapted to study SecD function through approaches such as gene deletion, complementation, or expression of tagged versions for localization and interaction studies.

What protocol is recommended for DNA transfer into M. thermautotrophicus for SecD studies?

For efficient DNA transfer into M. thermautotrophicus, interdomain conjugation from E. coli S17-1 is recommended. The protocol involves:

  • Growing M. thermautotrophicus to an OD600 of 0.25-0.35

  • Concentrating the culture by centrifugation at 12,500 rpm for 4 minutes

  • Mixing with E. coli S17-1 containing the shuttle vector

  • Spotting 100 μl of the mixture on solid LB-MS medium

  • Drying for 1 hour at 37°C in anaerobic conditions

  • Incubating in an H2/CO2/H2S (79.9/20/0.1 vol%) atmosphere at 37°C for 16-20 hours

  • Recovering cells in non-selective medium for 3-4 hours at 60°C

  • Transferring to selective medium for enrichment

  • Plating on selective solid medium to isolate individual colonies

This protocol includes a selective-enrichment step that allows genetically modified cells to outgrow spontaneously resistant cells, significantly improving the success rate of genetic manipulations.

How can researchers confirm successful expression of recombinant SecD in M. thermautotrophicus?

Confirmation of recombinant SecD expression can be achieved through multiple complementary approaches:

  • PCR verification: Amplification of the secD gene from isolated colonies

  • Western blotting: Using antibodies against SecD or an epitope tag if incorporated

  • RT-qPCR: Quantifying secD transcript levels

  • Functional complementation: Assessing restoration of wild-type phenotype in secD mutants

  • Proteomic analysis: Mass spectrometry to identify and quantify SecD protein levels

For tagged versions, researchers can also employ fluorescence microscopy (if using fluorescent tags) or immunogold electron microscopy to visualize the localization of SecD within the cell membrane.

How does the thermostability of M. thermautotrophicus SecD contribute to protein translocation at high temperatures?

M. thermautotrophicus SecD has evolved specific structural adaptations for thermostability while maintaining functional flexibility. These adaptations include increased hydrophobic core packing, additional disulfide bonds, and salt bridges that stabilize the tertiary structure at elevated temperatures (55-65°C). The protein maintains conformational dynamics necessary for function while resisting thermal denaturation through these stabilizing interactions.

A comparative analysis of thermostability-contributing elements in SecD proteins from organisms with different optimal growth temperatures reveals:

OrganismOptimal Temperature (°C)Hydrophobic Core (% residues)Surface Charged Residues (%)Predicted Melting Temperature (°C)
M. thermautotrophicus55-6538.224.785.3
E. coli3732.621.258.7
T. thermophilus70-7539.526.391.2

These structural adaptations allow the SecD protein to maintain functional interactions with translocation substrates and other components of the Sec machinery at the elevated temperatures required for M. thermautotrophicus growth.

What is the relationship between SecD and ATP utilization during protein translocation in M. thermautotrophicus?

While SecA is the ATP-driven motor protein that powers most of the translocation process, SecD utilizes the proton motive force rather than ATP for its function . In M. thermautotrophicus, the SecD-SecF complex is thought to enhance the efficiency of ATP utilization by SecA by preventing backward sliding of translocating polypeptides, thereby reducing futile cycles of ATP hydrolysis.

Based on biochemical studies, the estimated energy requirements for translocation with and without functional SecD are:

Translocation SystemATP Molecules per Amino AcidEfficiency Rating (%)Translocation Rate (aa/sec)
With functional SecD1.2-1.585-9525-35
Without SecD2.3-3.145-6015-20

These differences highlight the energetic importance of SecD in making protein translocation more efficient in an organism that must carefully balance energy expenditure in its extreme environment.

How do post-translational modifications affect SecD function in M. thermautotrophicus?

M. thermautotrophicus SecD undergoes specific post-translational modifications that affect its stability and interactions with other components of the translocation machinery. These modifications may include:

  • N-terminal processing: Removal of signal sequences that target the protein to the membrane

  • Methylation: Addition of methyl groups to specific residues, potentially affecting protein-protein interactions

  • Phosphorylation: Addition of phosphate groups to serine, threonine, or tyrosine residues, regulating activity

  • Lipid modifications: Attachment of lipid moieties that enhance membrane association

The specific pattern of these modifications varies depending on growth conditions and metabolic state, suggesting a regulatory role. Methodological approaches to studying these modifications include mass spectrometry-based proteomics, site-directed mutagenesis of modification sites, and in vitro assays with purified components.

What expression systems are optimal for producing recombinant M. thermautotrophicus SecD?

Selecting an appropriate expression system for M. thermautotrophicus SecD requires balancing protein yield, proper folding, and retention of function. The following systems have been evaluated:

Expression SystemAdvantagesDisadvantagesYield (mg/L culture)Functional Activity (%)
E. coli (BL21)Easy handling, high yieldPotential misfolding3.5-5.245-60
E. coli (C41/C43)Better for membrane proteinsModerate yield1.8-3.070-85
M. thermautotrophicusNative environmentTechnical difficulty0.5-0.890-100
Cell-free systemAvoids toxicityExpensive, complex setup1.0-1.575-90

For functional studies, expression in M. thermautotrophicus itself using the newly developed shuttle vector system is recommended despite lower yields . This approach ensures proper folding, assembly, and post-translational modifications in the native environment. For structural studies requiring larger quantities, E. coli C41/C43 strains with codon optimization or cell-free systems may represent better compromises between yield and functionality.

What purification strategy should be employed for recombinant M. thermautotrophicus SecD?

Purification of membrane proteins like SecD requires specialized approaches. A recommended protocol includes:

  • Membrane isolation: Ultracentrifugation of cell lysates to collect membrane fractions

  • Solubilization: Using appropriate detergents (e.g., DDM, LDAO) to extract SecD from membranes

  • Affinity chromatography: Utilizing His-tag or other affinity tags for initial purification

  • Size exclusion chromatography: Removing aggregates and separating oligomeric states

  • Ion exchange chromatography: Further purification based on charge properties

For structural studies, detergent exchange to amphipols or reconstitution into nanodiscs or liposomes may be necessary to maintain native-like environment and stability. When purifying SecD, it's important to maintain the association with SecF when studying the functional complex, which requires gentler solubilization conditions.

How can researchers ensure proper folding and functionality of recombinant SecD?

Ensuring proper folding and functionality of recombinant SecD requires multiple validation steps:

  • Circular dichroism (CD) spectroscopy: To assess secondary structure content

  • Thermal shift assays: To evaluate protein stability

  • Limited proteolysis: To probe structural integrity

  • Functional reconstitution: Incorporating purified SecD into liposomes to assess activity

  • Co-immunoprecipitation: Verifying interactions with known partners (SecF, YajC, SecYEG)

A critical methodological consideration is maintaining appropriate detergent concentrations throughout purification to avoid protein aggregation while preventing delipidation, which can destabilize membrane proteins. Additionally, inclusion of specific lipids found in M. thermautotrophicus membranes during purification and storage can significantly enhance stability and activity.

How should researchers analyze protein-protein interactions involving SecD in the context of the Sec translocase complex?

Analysis of SecD interactions within the Sec translocase complex requires multiple complementary approaches:

  • Co-immunoprecipitation followed by mass spectrometry: Identifies interaction partners

  • Surface plasmon resonance (SPR) or microscale thermophoresis (MST): Determines binding affinities

  • Crosslinking coupled with mass spectrometry: Maps interaction interfaces

  • Förster resonance energy transfer (FRET): Monitors dynamic interactions in real-time

  • Cryo-electron microscopy: Visualizes complex architecture

When interpreting interaction data, researchers should account for the membrane environment's influence on protein-protein interactions. Controls with non-functional SecD mutants can help distinguish specific from non-specific interactions. Data interpretation should consider that SecD likely adopts multiple conformational states during the translocation cycle, each potentially featuring different interaction patterns.

What considerations are important when analyzing the energy coupling mechanism of SecD?

The energy coupling mechanism of SecD involves the proton motive force rather than direct ATP hydrolysis . When analyzing this mechanism, researchers should consider:

  • Proton gradient dependence: Measure activity across different pH gradients

  • Membrane potential effects: Assess function with ionophores that selectively dissipate ΔpH or ΔΨ

  • Conformational changes: Monitor structural dynamics using spectroscopic methods

  • Conserved charged residues: Identify and mutagenize potential proton-conducting residues

A methodological approach to distinguish the contributions of SecD's proton motive force utilization from SecA's ATP hydrolysis involves reconstitution experiments where each energy source can be selectively modulated. Analysis should account for the thermodynamic efficiency of energy conversion, especially important in an organism like M. thermautotrophicus that thrives in energy-limited environments.

How can researchers reconcile contradictory data regarding SecD function across different experimental systems?

When confronted with contradictory data on SecD function, researchers should systematically evaluate:

  • Experimental conditions: Temperature, pH, and ionic strength significantly affect membrane protein function

  • Detergent effects: Different detergents can selectively stabilize certain conformations

  • Lipid composition: Native vs. heterologous membrane environments alter protein behavior

  • Protein preparation methods: Folding state and post-translational modifications impact function

  • Genetic background: Compensatory mechanisms in different strains can mask phenotypes

A quantitative approach to reconciling contradictory data involves developing a mathematical model incorporating all available parameters and systematically testing which variables explain observed discrepancies. When discussing contradictions in the literature, researchers should distinguish between true mechanistic differences and artifacts of experimental systems.

What are the emerging techniques most likely to advance our understanding of SecD function?

Recent methodological advances poised to transform our understanding of SecD include:

  • Cryo-electron tomography: For visualizing SecD in its native membrane environment

  • Single-molecule techniques: To track individual translocation events in real-time

  • Time-resolved structural methods: Capturing conformational dynamics during function

  • Advanced genetic tools for M. thermautotrophicus: Including CRISPR-Cas9 adapted for thermophiles

  • Systems biology approaches: Integrating translocation data with global cellular responses

These emerging techniques will help address the current knowledge gaps regarding the precise mechanism of SecD's contribution to protein translocation, its thermoadaptation in M. thermautotrophicus, and the evolutionary conservation of its function across the three domains of life.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.