Recombinant Methanothermobacter thermautotrophicus Putative biopolymer transport protein exbB homolog (MTH_1022)

Shipped with Ice Packs
In Stock

Description

Introduction to MTH_1022

Recombinant Methanothermobacter thermautotrophicus Putative biopolymer transport protein ExbB homolog (MTH_1022) is a protein that belongs to the ExbB family, involved in the transport of biopolymers across the cell membrane in Methanothermobacter thermautotrophicus . M. thermautotrophicus is a thermophilic archaeon known for its ability to produce methane at high temperatures . Understanding the function and characteristics of MTH_1022 can provide insights into the mechanisms of biopolymer transport and the adaptation strategies of thermophilic archaea to extreme environments .

Basic Information

CategoryDescription
NameRecombinant Full Length Methanothermobacter thermautotrophicus Putative Biopolymer Transport Protein ExbB Homolog (MTH_1022) Protein
SynonymsMTH_1022; Putative biopolymer transport protein ExbB homolog
SourceE. coli
SpeciesMethanothermobacter thermautotrophicus
UniProt IDO27101
Molecular Weightapproximately 31.4 kDa
PurityGreater than 85-90% as determined by SDS-PAGE
Tag InfoN-terminal His-tag or Tag type will be determined during the manufacturing process
Protein LengthFull Length (1-279aa) or Partial
FormLyophilized powder
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL; add 5-50% glycerol for long-term storage
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Storage ConditionStore at -20°C/-80°C upon receipt; avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week
AA SequenceMFLDPVINFFGTVLEMFRSGGVITYLIAAIGIYGFITALEKIHYLRKISRVSTPQIIGAVNESMEKGGALEALREIGQYQNPVSKIISEALKIGYRNRSEVEDAMERVFIVEMSNMTRGLGTLRTIIEVAPMLGLIGTVIGIWYTFRALGVNADPAAMAEGIYVALITTILGLAVAIILMPLYSYITGRIDDEIDKIELIKKMTNWGYAVMRISVEGNVDDVVKALMESDGVVSVRVVDEPDANVVVAFKPSMLEKSINNIIIERCGKSAEIIESKLRQ

Function and Role

MTH_1022 is annotated as a putative biopolymer transport protein ExbB homolog . ExbB proteins are typically involved in energy transduction complexes that facilitate the transport of large molecules across the cell envelope in bacteria and archaea. These complexes often include ExbB, ExbD, and TonB proteins .

  • Biopolymer Transport: MTH_1022 likely plays a role in the uptake or export of biopolymers, which could include polysaccharides, proteins, or other large molecules.

  • Energy Transduction: As an ExbB homolog, MTH_1022 may be part of a larger complex that couples energy from the proton motive force to drive the transport process.

  • Membrane Integrity and Biogenesis: MTH_1022, may participate in maintaining cell membrane/wall/envelope biogenesis .

Expression and Purification

MTH_1022 is often produced using recombinant DNA technology in E. coli . The protein is expressed with a His-tag, which allows for purification using affinity chromatography .

  • Expression System: E. coli is commonly used as the expression host due to its rapid growth and well-established molecular biology tools .

  • Purification: Affinity chromatography, using nickel-NTA resin, is used to purify the His-tagged MTH_1022 protein .

  • Purity Assessment: SDS-PAGE is used to verify the purity of the protein, which is typically greater than 85% .

Research Findings and Studies

While specific research on MTH_1022 itself may be limited, studies involving Methanothermobacter thermautotrophicus provide relevant context .

  • Temperature Stress Response: Proteomic analysis of M. thermautotrophicus under different temperatures indicates that proteins involved in environmental information processing and cell membrane biogenesis play key roles in methane formation and adaptive responses .

  • Methanogenesis: MTH_1022 may indirectly affect methane formation by influencing the transport of essential nutrients or regulatory molecules .

Potential Applications

Understanding the function of MTH_1022 and similar biopolymer transport proteins has several potential applications :

  • Biotechnology: Engineering archaeal transport systems for the production of valuable biopolymers or biofuels.

  • Drug Development: Targeting bacterial transport systems to develop new antimicrobial agents.

  • Environmental Science: Understanding how archaea adapt to extreme environments and contribute to global biogeochemical cycles.

Related Products

  • Recombinant Proteins: Recombinant Full Length Methanothermobacter Thermautotrophicus Putative Biopolymer Transport Protein ExbB Homolog (MTH_1022) Protein, His-Tagged

  • ELISA Kits: ELISA Recombinant Methanothermobacter thermautotrophicus Putative biopolymer transport protein exbB homolog (MTH_1022)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us during the ordering process, and we will prioritize its use.
Synonyms
MTH_1022; Putative biopolymer transport protein ExbB homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-279
Protein Length
full length protein
Species
Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)
Target Names
MTH_1022
Target Protein Sequence
MFLDPVINFFGTVLEMFRSGGVITYLIAAIGIYGFITALEKIHYLRKISRVSTPQIIGAV NESMEKGGALEALREIGQYQNPVSKIISEALKIGYRNRSEVEDAMERVFIVEMSNMTRGL GTLRTIIEVAPMLGLIGTVIGIWYTFRALGVNADPAAMAEGIYVALITTILGLAVAIILM PLYSYITGRIDDEIDKIELIKKMTNWGYAVMRISVEGNVDDVVKALMESDGVVSVRVVDE PDANVVVAFKPSMLEKSINNIIIERCGKSAEIIESKLRQ
Uniprot No.

Target Background

Database Links
Protein Families
ExbB/TolQ family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the function of MTH_1022 in Methanothermobacter thermautotrophicus compare to ExbB in bacteria?

In bacterial systems, ExbB works as part of the TonB-ExbB-ExbD complex, which harvests energy from the proton motive force (pmf) of the cytoplasmic membrane and transmits it to TonB for energizing outer membrane transport . The ExbB component forms a pentameric structure with a central pore where ExbD dimers reside . This complex functions as a molecular motor that converts electrochemical energy from the pmf into mechanical energy that can be utilized for transport processes across the outer membrane .

What are the optimal storage and handling conditions for recombinant MTH_1022 protein?

For optimal results when working with recombinant MTH_1022 protein, researchers should follow these storage and handling guidelines:

  • The protein is typically supplied as a lyophilized powder .

  • Upon receipt, store the protein at -20°C or -80°C .

  • Aliquoting is necessary for multiple use to prevent protein degradation from repeated freeze-thaw cycles .

  • For working solutions, store aliquots at 4°C for up to one week .

  • The protein is typically stored in a Tris/PBS-based buffer containing 6% Trehalose, pH 8.0 .

  • When reconstituting the protein, the vial should be briefly centrifuged prior to opening to bring the contents to the bottom .

Avoid repeated freeze-thaw cycles as this can significantly reduce protein activity and stability . The addition of trehalose in the storage buffer helps maintain protein structure during the freeze-drying process and subsequent storage.

What experimental approaches can be used to investigate the potential role of MTH_1022 in energy transduction?

Investigating the energy transduction role of MTH_1022 requires a multi-faceted experimental approach:

  • Membrane Reconstitution Assays

    • Purified MTH_1022 can be reconstituted into liposomes with a defined lipid composition to mimic the archaeal membrane environment.

    • Proton translocation assays using pH-sensitive fluorescent dyes can determine if MTH_1022 participates in proton transport across membranes.

    • Compare results with known bacterial ExbB proteins to identify functional similarities and differences .

  • Protein-Protein Interaction Studies

    • Identify potential interaction partners in M. thermautotrophicus that might function analogously to TonB and ExbD in bacterial systems.

    • Methods include co-immunoprecipitation, bacterial/yeast two-hybrid assays, and crosslinking experiments followed by mass spectrometry.

    • Based on bacterial ExbB-ExbD interactions, investigate whether MTH_1022 forms oligomeric structures (potentially pentamers) and interacts with ExbD-like proteins .

  • Site-Directed Mutagenesis

    • Generate mutations in conserved residues between bacterial ExbB and MTH_1022 to assess their importance for function.

    • Focus on residues implicated in proton conduction channels or protein-protein interactions based on bacterial ExbB studies .

  • Structural Analysis

    • Employ cryo-EM or X-ray crystallography to determine the three-dimensional structure of MTH_1022, individually or in complex with interaction partners.

    • Compare with the known structures of bacterial ExbB pentamers to identify structural conservation and divergence .

These experimental approaches would provide comprehensive insights into whether MTH_1022 functions analogously to bacterial ExbB in energy transduction systems, despite the architectural differences between archaeal and bacterial cell envelopes.

How might temperature adaptation affect the structure-function relationship of MTH_1022 compared to mesophilic ExbB proteins?

Methanothermobacter thermautotrophicus is a thermophilic archaeon with optimal growth at 65-70°C and maximal growth temperature of 75°C . This thermophilic lifestyle likely influences the structure-function relationship of MTH_1022 in several ways:

  • Protein Stability Adaptations

    • Thermophilic proteins typically show increased hydrophobic core packing, additional salt bridges, and reduced flexible loops compared to mesophilic homologs.

    • The amino acid composition of MTH_1022 (high proportion of charged and hydrophobic residues) suggests adaptations for stability at high temperatures .

  • Membrane Fluidity Considerations

    • M. thermautotrophicus maintains appropriate membrane fluidity at high temperatures through specialized lipid compositions.

    • MTH_1022, as a membrane protein, likely has adapted its transmembrane domains to interact optimally with these specialized archaeal lipids.

  • Energy Transduction Efficiency

    • Comparative activity assays examining proton translocation or ATP utilization efficiency across a temperature range (30-80°C) could reveal how MTH_1022 is optimized for function at thermophilic temperatures.

    • Expected results would show peak activity around 65-70°C, mirroring the organism's growth optimum, similar to the temperature response observed for other M. thermautotrophicus proteins like Mth212 .

  • Conformational Flexibility Trade-offs

    • Thermophilic proteins often sacrifice conformational flexibility for stability, potentially affecting MTH_1022's dynamic properties during energy transduction.

    • Molecular dynamics simulations at different temperatures could predict differences in conformational behavior between MTH_1022 and mesophilic ExbB proteins.

Understanding these thermal adaptations could provide insights into how membrane-based energy transduction systems function in extreme environments and might inspire the development of thermostable biotechnological applications.

What is the evolutionary relationship between archaeal ExbB homologs and bacterial ExbB proteins?

The evolutionary relationship between archaeal ExbB homologs like MTH_1022 and bacterial ExbB proteins presents an intriguing question in membrane transport system evolution:

  • Sequence Homology Analysis

    • While MTH_1022 shows sequence similarity to bacterial ExbB proteins, significant differences exist, reflecting the divergence between archaea and bacteria.

    • Phylogenetic analysis would likely place archaeal ExbB homologs on a distinct branch from bacterial ExbB proteins, with varying degrees of sequence conservation in functional domains.

  • Functional Domain Conservation

    • Key domains for energy harvesting from the proton motive force are likely conserved between bacterial ExbB and MTH_1022 .

    • Transmembrane regions involved in forming the pentameric complex structure would show higher conservation than peripheral regions .

  • Genomic Context Analysis

    • In bacteria, exbB genes are typically co-localized with exbD and tonB genes in operons .

    • Analysis of the genomic neighborhood of MTH_1022 might reveal archaeal-specific partner proteins that functionally replace bacterial ExbD and TonB.

  • Structural Homology Despite Sequence Divergence

    • Even with moderate sequence similarity, archaeal and bacterial ExbB proteins might maintain similar three-dimensional structures, particularly in the transmembrane domains that form the pentameric complex.

    • This would represent a case of structural conservation despite sequence divergence, highlighting the fundamental importance of the energy transduction mechanism.

This evolutionary analysis helps place MTH_1022 in the broader context of membrane transport systems and provides insights into the conservation and divergence of essential cellular processes across domains of life.

What expression and purification strategies are most effective for obtaining high-quality recombinant MTH_1022?

Obtaining high-quality recombinant MTH_1022 protein requires optimized expression and purification strategies tailored to this thermophilic membrane protein:

  • Expression System Selection

    • E. coli is commonly used for recombinant expression of MTH_1022, with BL21(DE3) or C41/C43(DE3) strains being particularly suitable for membrane proteins .

    • Expression vectors with tightly controlled promoters (like pET systems) allow for regulated expression to prevent toxicity .

  • Optimization Protocol

    • Temperature: Lower induction temperatures (16-25°C) often increase the yield of properly folded membrane proteins despite the thermophilic nature of the native protein.

    • Induction: Low IPTG concentrations (0.1-0.5 mM) and extended expression times (16-20 hours) typically yield better results.

    • Media supplementation with glycerol (0.5-1%) can improve membrane protein expression.

  • Purification Strategy

    • Cell lysis should be performed using methods that effectively solubilize membrane proteins (e.g., sonication in the presence of appropriate detergents).

    • Primary purification utilizing Ni²⁺ IMAC (Immobilized Metal Affinity Chromatography) takes advantage of the His-tag .

    • Secondary purification using ion exchange or size exclusion chromatography improves purity.

  • Detergent Selection Table

DetergentCMC (mM)AdvantagesDisadvantages
DDM0.17Mild, maintains protein structureLarge micelles
LDAO1-2Good for crystallizationCan be destabilizing
Fos-Choline-121.5Highly effective solubilizerPotentially denaturing
LMNG0.01Stable, small micellesExpensive
  • Quality Control Methods

    • SDS-PAGE to verify purity (>90% purity is typically achievable)

    • Western blotting to confirm identity

    • Circular dichroism to assess secondary structure

    • Dynamic light scattering to evaluate homogeneity

For functional studies, reconstitution into liposomes or nanodiscs might be necessary to study MTH_1022 in a membrane-like environment that better mimics its native state.

How can researchers analyze the oligomeric state and structure of MTH_1022?

Based on bacterial ExbB proteins, which form pentamers , analyzing the oligomeric state and structure of MTH_1022 requires specialized techniques for membrane proteins:

  • Analytical Ultracentrifugation (AUC)

    • Sedimentation velocity experiments can determine the oligomeric state of detergent-solubilized MTH_1022.

    • Expected results would show sedimentation coefficients consistent with pentameric assemblies if MTH_1022 behaves similarly to bacterial ExbB.

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS)

    • This technique separates protein complexes based on size while simultaneously measuring their absolute molecular weight.

    • For membrane proteins like MTH_1022, detergent contributions must be carefully accounted for using appropriate calibration and calculation methods.

  • Chemical Crosslinking

    • Bifunctional crosslinkers targeting lysine residues or other amino acids can capture transient protein-protein interactions.

    • Analysis of crosslinked products by SDS-PAGE and mass spectrometry can reveal oligomeric states and interaction interfaces.

  • Native Mass Spectrometry

    • Emerging techniques in native MS allow for analysis of intact membrane protein complexes ejected from detergent micelles or nanodiscs.

    • This approach can provide precise mass measurements of the entire complex and individual subunits.

  • Structural Techniques

    • Cryo-electron microscopy (cryo-EM) is particularly suitable for membrane protein complexes like MTH_1022.

    • X-ray crystallography, while challenging for membrane proteins, could provide high-resolution structural information if suitable crystals can be obtained.

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map interaction surfaces and conformational changes in the protein complex.

Combining multiple complementary techniques provides the most robust assessment of MTH_1022's oligomeric state and structure, which is essential for understanding its molecular mechanism in membrane transport.

What methods are suitable for investigating potential interaction partners of MTH_1022 in Methanothermobacter thermautotrophicus?

Identifying interaction partners of MTH_1022 is crucial for understanding its functional context in M. thermautotrophicus. Based on bacterial ExbB proteins, which interact with ExbD and TonB , the following methods are recommended:

  • Co-Immunoprecipitation from Native Source

    • Generate antibodies against recombinant MTH_1022 for immunoprecipitation from M. thermautotrophicus lysates.

    • Mass spectrometry analysis of co-precipitated proteins can identify interaction partners.

    • Challenges include maintaining interactions during solubilization and the need for specific antibodies.

  • Bacterial Two-Hybrid System (Adapted for High Temperature)

    • Construct fusion proteins of MTH_1022 and candidate partners with split reporter domains.

    • Use temperature-resistant E. coli strains for screening to better mimic the thermophilic environment.

    • This approach allows systematic screening of potential interactions from a genomic library.

  • In vitro Pull-Down Assays

    • Immobilize purified His-tagged MTH_1022 on Ni²⁺ resin and incubate with M. thermautotrophicus lysate .

    • After washing, elute and identify bound proteins by mass spectrometry.

    • Control experiments with unrelated His-tagged proteins help distinguish specific from non-specific interactions.

  • Chemical Crosslinking Coupled with Mass Spectrometry (XL-MS)

    • Treat intact M. thermautotrophicus cells or membrane fractions with membrane-permeable crosslinkers.

    • Identify crosslinked peptides by tandem mass spectrometry to map protein-protein interactions at the residue level.

    • This approach captures interactions in their native cellular context.

  • Proximity Labeling

    • Express MTH_1022 fused to a biotin ligase (BioID) or peroxidase (APEX) in M. thermautotrophicus.

    • These enzymes biotinylate nearby proteins, which can then be purified and identified.

    • While technically challenging in archaea, this approach provides valuable spatial interaction information.

  • Genomic Context Analysis

    • Analyze genes co-localized with MTH_1022 in the M. thermautotrophicus genome.

    • Genes in the same operon or genomic neighborhood often encode functionally related proteins.

    • Comparative genomics with related archaeal species can strengthen predictions.

By combining multiple complementary approaches, researchers can build a comprehensive interaction network centered on MTH_1022, providing insights into its functional role in M. thermautotrophicus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.