Recombinant Methanothermobacter thermautotrophicus Tetrahydromethanopterin S-methyltransferase subunit B (mtrB)

Shipped with Ice Packs
In Stock

Description

Role in Methanogenesis

mtrB is a subunit of the N₅-methyltetrahydromethanopterin:coenzyme M methyltransferase (Mtr) complex, which couples methyl transfer with sodium ion (Na⁺) transport. This reaction is essential for maintaining the proton gradient required for ATP synthesis in methanogens . The enzyme belongs to EC 2.1.1.86 and operates reversibly under specific conditions .

Key Biochemical PropertiesDetails
Enzyme ClassTransferase (methyltransferase)
ReactionCH₃-H₄MPT + CoM → H₄MPT + CH₃-CoM
CofactorsVitamin B₁₂ derivative (cobamide) in the Mtr complex
Subcellular LocalizationCytoplasmic (associated with the Mtr membrane complex)

Recombinant Production

The recombinant mtrB protein is expressed in E. coli with an N-terminal His-tag for purification. Key specifications include:

ParameterValue
SourceMethanothermobacter thermautotrophicus (strain ΔH)
Expression SystemE. coli
Protein LengthFull-length (1–100 amino acids)
TagN-terminal 10xHis-tag
Purity>90% (SDS-PAGE analysis)
UniProt IDO27228

Amino Acid Sequence

The full-length mtrB sequence is:
MEMLPLVKIAPEYNLTLDPSTGMIGAALGREVIILSMDEINEQIAELEATADDLINSLDP TTTPLDSYPGREGVYLTAGKLTNMVYGFILGLIILFALLL .

Sequence FeatureSignificance
Membrane AnchorContains a single transmembrane helix (MtrB)
Cobamide BindingInteracts with MtrA, which harbors the cobamide prosthetic group

Mtr Complex Architecture

Cryo-EM studies reveal that mtrB is part of the MtrABCDEFGH complex, which includes:

  • MtrCDE: Membrane-spanning subunits forming a Na⁺ channel.

  • MtrABFG: Peripheral subunits stabilizing the cobamide and methyl transfer .
    The complex adopts a trimeric structure with tetraether glycolipids filling interstitial spaces .

Functional Studies

  1. Fe(III) Reduction
    M. thermautotrophicus reduces Fe(III) oxides (e.g., ferrihydrite) during methanogenesis. mtrB may indirectly support this process by maintaining redox balance via methyl transfer .

  2. Temperature Stress Responses
    Proteomic analyses show that mtrB expression is downregulated under high (71°C) and low (4°C) temperatures, correlating with reduced methane production .

  3. Membrane Adaptation
    Under nutrient limitation, M. thermautotrophicus modulates membrane lipids (e.g., glycolipids) to enhance barrier function, potentially involving mtrB-associated metabolic adjustments .

Comparative Data on Recombinant mtrB

Product CodeSupplierFormKey Features
RFL26005MFCreative BioMartLyophilized powderHis-tagged, >90% purity, E. coli-expressed
CSB-CF517962MSRCusabioLyophilized powderFull-length, 10xHis-tag, E. coli-expressed

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
mtrB; MTH_1160; Tetrahydromethanopterin S-methyltransferase subunit B; N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)
Target Names
mtrB
Target Protein Sequence
MEMLPLVKIAPEYNLTLDPSTGMIGAALGREVIILSMDEINEQIAELEATADDLINSLDP TTTPLDSYPGREGVYLTAGKLTNMVYGFILGLIILFALLL
Uniprot No.

Target Background

Function
This protein is a component of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This process is an energy-conserving, sodium-ion translocating step.
Database Links
Protein Families
MtrB family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the role of mtrB in methanogenesis?

Tetrahydromethanopterin S-methyltransferase subunit B (mtrB) is a critical component of the methyl-tetrahydromethanopterin:coenzyme M methyltransferase (Mtr) complex in methanogenic archaea. The Mtr complex catalyzes the transfer of methyl groups from methyl-tetrahydromethanopterin (CH₃-H₄MPT) to 2-mercaptoethanesulfonate (CoM), forming methyl-CoM, which is a key intermediate in the final stages of methanogenesis . The mtrB subunit, specifically, contributes to the membrane-associated activities of the Mtr complex, which couples this methyl transfer reaction to sodium ion (Na⁺) pumping across the cell membrane, thereby generating an electrochemical gradient that drives ATP synthesis .

How does mtrB function within the larger Mtr complex?

The Mtr complex is composed of eight different subunits (MtrABCDEFGH) that work in concert to couple methyl transfer with Na⁺ pumping. While MtrCDE are integral membrane proteins, mtrB, along with MtrAFG, possesses a single membrane-spanning helix that serves as a membrane anchor . The complete Mtr complex functions as a trimer with a molecular mass of approximately 430 kDa. The methyl transfer process occurs in a two-step reaction, where the cobalt-containing vitamin B₁₂ derivative serves as an intermediate methyl carrier. The mtrB subunit specifically contributes to the stability and proper assembly of this multi-subunit complex, ensuring efficient coupling between methyl transfer and ion translocation .

What are the optimal storage conditions for recombinant mtrB?

For long-term storage of recombinant mtrB, the following protocol is recommended:

  • Store the lyophilized powder at -20°C to -80°C upon receipt

  • After reconstitution, aliquot the protein to avoid repeated freeze-thaw cycles

  • Add glycerol to a final concentration of 5-50% (optimally 50%) before aliquoting

  • Store working aliquots at 4°C for up to one week to minimize protein degradation

It's important to note that repeated freezing and thawing significantly reduces protein activity and should be avoided. For reconstitution, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL in a Tris/PBS-based buffer (pH 8.0) containing 6% trehalose .

How can researchers verify the activity of recombinant mtrB?

Since mtrB functions as part of the larger Mtr complex, assessing its activity in isolation presents challenges. Researchers should consider the following methodological approaches:

  • Complex reconstitution assays: Combine purified recombinant mtrB with other Mtr subunits to reconstruct the functional complex in vitro, then measure methyl transfer activity from CH₃-H₄MPT to CoM.

  • Complementation studies: Express recombinant mtrB in mtrB-deficient methanogenic strains and assess restoration of methanogenesis.

  • Binding partner verification: Use pull-down assays or surface plasmon resonance to confirm interactions with other Mtr subunits, particularly MtrA and MtrC.

  • Na⁺ translocation assays: Incorporate the reconstituted complex into liposomes and measure Na⁺ translocation coupled to methyl transfer activity.

When performing these assays, researchers should maintain anaerobic conditions throughout, as the enzyme is oxygen-sensitive. The optimal pH for methyl transfer activity is approximately 6.7, and assays should be conducted at temperatures suitable for thermophilic proteins (around 65-70°C for M. thermautotrophicus proteins) .

What purification strategies yield the highest purity of recombinant mtrB?

A systematic purification protocol for recombinant His-tagged mtrB typically involves:

  • Cell lysis: Disrupt E. coli cells expressing recombinant mtrB using sonication or pressure-based methods in anaerobic buffers containing protease inhibitors.

  • Initial clarification: Centrifuge lysate at 10,000-15,000 × g to remove cell debris.

  • Membrane fraction isolation: Ultracentrifuge the supernatant at >100,000 × g to pellet membrane fractions containing mtrB.

  • Detergent solubilization: Resuspend membrane pellet in buffer containing mild detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS) to solubilize membrane proteins.

  • Ni-NTA affinity chromatography: Apply solubilized fraction to Ni-NTA resin, wash extensively, and elute with imidazole gradient.

  • Size exclusion chromatography: Further purify by gel filtration to separate monomeric mtrB from aggregates and other proteins.

  • Purity assessment: Confirm purity by SDS-PAGE (>90% purity is achievable) and identity by western blotting or mass spectrometry .

For structural studies, researchers should consider additional purification steps such as ion exchange chromatography to achieve >95% purity.

How does temperature affect mtrB structure and function?

Methanothermobacter thermautotrophicus is a thermophilic archaeon with optimal growth at elevated temperatures (around 65-70°C). Recombinant mtrB exhibits thermal stability consistent with its thermophilic origin.

Temperature effects on mtrB include:

  • Structural integrity: At temperatures below 50°C, the protein may not assume its optimal conformation, potentially affecting complex assembly and function.

  • Activity range: The methyl transfer activity mediated by the Mtr complex shows temperature dependence, with optimal activity at temperatures matching the growth optimum of M. thermautotrophicus.

  • Cold stress response: Under cold shock conditions (e.g., 4°C), M. thermautotrophicus undergoes proteomic changes that may affect expression and stability of Mtr complex components, including mtrB .

  • Thermal denaturation: Complete inactivation occurs when the enzyme is heated to 100°C for 5 minutes, suggesting a denaturation threshold between the optimal growth temperature and 100°C .

Researchers studying temperature effects should consider using circular dichroism spectroscopy to monitor structural changes and thermal shift assays to determine the melting temperature (Tm) of recombinant mtrB.

What is known about mtrB interactions with other Mtr complex subunits?

The Mtr complex functions as a highly coordinated assembly of eight different subunits. mtrB interactions include:

  • Membrane integration: mtrB contains a single membrane-spanning helix that anchors it to the membrane, positioning it for interactions with the integral membrane subunits MtrCDE .

  • Complex assembly: The Mtr complex forms a trimeric structure with a molecular mass of approximately 430 kDa, suggesting that multiple copies of each subunit, including mtrB, participate in complex formation .

  • Subunit proximity: Cryo-EM structural studies of the Mtr complex from related methanogenic archaea provide insights into the spatial arrangement of subunits, including mtrB's position relative to other components .

The following table summarizes the key interactions between mtrB and other Mtr subunits:

Interacting SubunitNature of InteractionFunctional Significance
MtrAProximity interactionFacilitates methyl transfer from MtrA's cobamide to CoM
MtrCMembrane domain interactionContributes to Na⁺ translocation coupling
MtrEIndirect structural interactionStabilizes complex architecture
MtrHTransient associationEnables methyl group acquisition from CH₃-H₄MPT

What are common troubleshooting issues when working with recombinant mtrB?

Researchers frequently encounter several challenges when working with recombinant mtrB:

  • Protein aggregation: Due to its hydrophobic membrane-spanning domain, mtrB has a tendency to aggregate during expression and purification. This can be mitigated by optimizing detergent type and concentration during extraction and maintaining appropriate protein concentrations.

  • Oxygen sensitivity: As a component of the methyl transfer system in strictly anaerobic methanogens, mtrB is sensitive to oxygen exposure. Maintaining anaerobic conditions throughout purification and functional assays is critical .

  • Expression levels: Heterologous expression in E. coli may yield lower protein levels due to codon usage differences and the presence of transmembrane domains. Codon optimization and use of specialized E. coli strains can improve expression.

  • Activity reconstitution: Isolated mtrB may not exhibit activity without other Mtr subunits. Researchers should consider co-expression systems or reconstitution approaches to study functional properties.

  • Stability during storage: Recombinant mtrB may lose activity during storage. Proper buffer composition, including stabilizing agents like trehalose, and appropriate storage conditions are essential .

How can researchers distinguish between mtrB from different methanogenic species?

Methanogenic archaea across different genera possess mtrB homologs with varying degrees of sequence conservation. Researchers can employ the following approaches to distinguish between mtrB variants:

  • Sequence alignment analysis: Compare amino acid sequences using multiple sequence alignment tools to identify conserved domains and species-specific regions.

  • Immunological methods: Develop antibodies against species-specific epitopes for western blot or immunoprecipitation-based identification.

  • Mass spectrometry: Utilize peptide mass fingerprinting or tandem MS to identify unique peptide markers for different mtrB homologs.

  • Functional characterization: Compare biochemical properties such as temperature optima, pH dependence, and kinetic parameters, which may vary between species.

  • Phylogenetic analysis: Construct phylogenetic trees based on mtrB sequences to understand evolutionary relationships and functional divergence.

When studying M. thermautotrophicus mtrB specifically, researchers should be aware of the potential for contamination with homologs from other species and employ appropriate controls for species verification.

What role does mtrB play in the adaptation of Methanothermobacter thermautotrophicus to extreme conditions?

M. thermautotrophicus inhabits environments with varying temperatures and has developed mechanisms to maintain methanogenesis under changing conditions. The role of mtrB in adaptation includes:

  • Thermal adaptation: As a thermophilic archaeon, M. thermautotrophicus contains proteins, including mtrB, with enhanced thermal stability. The amino acid composition and structural features of mtrB likely contribute to its thermostability.

  • Cold stress response: Comparative proteomic analyses have shown that M. thermautotrophicus undergoes significant protein expression changes under cold shock conditions (4°C). Understanding how mtrB expression and function are regulated under these conditions provides insights into adaptation mechanisms .

  • Membrane fluidity modulation: As a membrane-anchored protein, mtrB must maintain functionality despite changes in membrane fluidity at different temperatures. Structural adjustments in mtrB may contribute to maintaining Mtr complex function across temperature ranges.

  • Energy conservation: The Mtr complex couples methyl transfer to Na⁺ pumping, a crucial energy conservation mechanism. How this coupling is maintained under varying environmental conditions remains an important research question.

Researchers investigating these aspects should consider employing transcriptomic and proteomic approaches to monitor mtrB expression under different conditions, combined with functional assays to assess activity and complex stability.

What are the kinetic parameters of methyl transfer reactions involving the Mtr complex?

Understanding the kinetics of methyl transfer reactions catalyzed by the Mtr complex provides fundamental insights into methanogenesis energetics. Key kinetic considerations include:

  • Substrate affinities: The Mtr complex utilizes CH₃-H₄MPT as a methyl donor and CoM as a methyl acceptor. Determining Km values for these substrates under various conditions helps characterize the enzymatic efficiency.

  • Reaction reversibility: The methyl transfer reaction catalyzed by the Mtr complex is reversible. The demethylation of methyl-CoM in the absence of methane synthesis depends on the addition of H₄MPT, suggesting equilibrium dynamics that merit quantitative investigation .

  • pH dependence: The methyl transfer activity shows a well-defined pH optimum at approximately pH 6.7. Characterizing the full pH-activity profile provides insights into catalytic mechanisms and physiologically relevant parameters .

  • Temperature effects: As a thermophilic enzyme complex, the Mtr system exhibits temperature-dependent activity profiles that reflect adaptation to high-temperature environments.

  • Na⁺ concentration effects: Since methyl transfer is coupled to Na⁺ pumping, the concentration of Na⁺ likely affects reaction kinetics through allosteric mechanisms.

To determine these parameters, researchers should employ steady-state kinetic analyses, stopped-flow spectroscopy for rapid kinetics, and isotope labeling approaches to track methyl group transfer.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.