Recombinant Methanothermobacter thermautotrophicus Uncharacterized protein MTH_137 (MTH_137)

Shipped with Ice Packs
In Stock

Description

Biological Relevance

  • MTH_137 is cataloged in the M. thermautotrophicus genome, which encodes ~1,869 protein genes involved in hydrogenotrophic methanogenesis .

  • Proteomic studies of M. thermautotrophicus highlight dynamic membrane lipid composition under energy stress , though MTH_137’s role in these processes remains unconfirmed.

Experimental Use Cases

  • Structural Studies: Recombinant MTH_137 is utilized in ELISA-based assays to explore antigen-antibody interactions, likely due to its stability in thermophilic conditions .

  • Hypothesis-Driven Research: The protein’s uncharacterized status positions it as a candidate for investigating novel metabolic or regulatory pathways in archaea .

Genomic and Proteomic Associations

  • Operon Context: MTH_137 resides in a genomic region with genes linked to membrane-associated processes, though direct functional linkages are unverified .

  • Protein Complexes: M. thermautotrophicus expresses energy-generating complexes (e.g., methyltransferase and ATP synthase) , but MTH_137 has not been identified in these assemblies.

Limitations and Research Gaps

  • Functional Annotation: No direct enzymatic or structural data for MTH_137 exists in public databases or literature.

  • Regulatory Mechanisms: The protein’s expression profile during growth phases or stress (e.g., hydrogen limitation) is undocumented .

Future Directions

  • Functional Genomics: CRISPR-based knockout studies could elucidate MTH_137’s role in M. thermautotrophicus .

  • Structural Biology: Cryo-EM or X-ray crystallography may resolve its tertiary structure and ligand-binding sites.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
MTH_137; Uncharacterized protein MTH_137
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)
Target Names
MTH_137
Target Protein Sequence
MRSSVGEFMIYQVIGTVIGIAGIIVSFARFRESRTSPGGLLLWLILWVSVILFSLNPPFS TRIANLLGIGRGLDFLLIIGILGAYYLLFRIYLMVDRIQQDITELVHEIALREHDD
Uniprot No.

Target Background

Database Links

KEGG: mth:MTH_137

STRING: 187420.MTH137

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.