Recombinant Methanothermobacter thermautotrophicus Uncharacterized protein MTH_1706 (MTH_1706)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant MTH_1706 is produced in E. coli systems and purified via affinity chromatography leveraging the His tag . Critical production parameters include:

  • Expression System: E. coli (optimized for thermophilic protein solubility) .

  • Form: Lyophilized powder in Tris/PBS-based buffer with 6% trehalose (pH 8.0) .

  • Reconstitution: Recommended in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage at -20°C/-80°C .

  • Storage: Single-use aliquots to avoid repeated freeze-thaw cycles .

Biochemical Properties

Biochemical analyses reveal the following traits:

ParameterObservation
ThermostabilityPresumed stable at high temperatures (source organism growth at 65°C) .
SolubilityEnhanced by glycerol (50% recommended) .
Aggregation TendencyLow (purity >90% under optimized conditions) .

The protein’s lyophilized form retains activity for extended periods, making it suitable for structural studies or antibody production .

Functional Insights and Hypotheses

While MTH_1706 remains functionally uncharacterized, contextual clues from M. thermautotrophicus biology suggest potential roles:

  • Membrane Dynamics: M. thermautotrophicus modulates membrane lipids under stress (e.g., nutrient/energy limitation), hinting at possible involvement of uncharacterized proteins in lipid or ion transport .

  • Protein Complexes: Proteomic studies identified novel complexes in this archaeon, though MTH_1706 was not explicitly linked .

  • Genetic Tools: Recent shuttle-vector systems for M. thermautotrophicus enable future gene knockout studies to elucidate MTH_1706’s role .

Research Applications

Recombinant MTH_1706 is primarily utilized in:

  • Antibody Development: As an immunogen due to its purity and unique sequence .

  • Enzyme-Linked Immunosorbent Assay (ELISA): Commercial kits employ this protein for analyte detection .

  • Structural Biology: Crystallography or NMR studies to resolve its 3D conformation .

Key Research Findings

Recent studies on M. thermautotrophicus provide indirect insights:

Study FocusRelevance to MTH_1706
Membrane Lipid ModulationStress-induced lipid remodeling highlights regulatory mechanisms possibly involving MTH_1706 .
Metabolic FlexibilityStrain-specific metabolic rates suggest uncharacterized proteins may fine-tune pathways .
Genetic Engineering AdvancesShuttle vectors enable targeted studies of MTH_1706’s function in vivo .

Challenges and Future Directions

The lack of functional annotation for MTH_1706 underscores the need for:

  1. Knockout Mutant Analyses: To assess phenotypic impacts under varying growth conditions.

  2. Interaction Studies: Yeast two-hybrid or co-IP assays to identify binding partners.

  3. Structural Resolution: Determining its 3D structure to infer mechanistic roles.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please include any such preferences in your order remarks and we will prepare accordingly.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, and customers can use this as a reference.
Shelf Life
Shelf life is dependent on various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
MTH_1706; Uncharacterized protein MTH_1706
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)
Target Names
MTH_1706
Target Protein Sequence
MNARDKKFMTAGIIIALIIAVLAPFLASPNPDGLESTAEKVMPNPETEPVLESPLPDYTL PALGDSPFGGVVSMVIGTILVLAIAYGVGAVFRGRKAAGEEGGEE
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the structure and sequence characteristics of MTH_1706?

MTH_1706 is a small protein consisting of 105 amino acids from the thermophilic archaeon Methanothermobacter thermautotrophicus. The complete amino acid sequence is "MNARDKKFMTAGIIIALIIAVLAPFLASPNPDGLESTAEKVMPNPETEPVLESPLPDYTLPALGDSPFGGVVSMVIGTILVLAIAYGVGAVFRGRKAAGEEGGEE" . Based on sequence analysis, MTH_1706 appears to have hydrophobic regions suggesting it may be a membrane-associated protein. The presence of multiple hydrophobic amino acid stretches in its sequence is consistent with transmembrane domains.

Sequence analysis indicates several key features that may provide clues to its function. These include a relatively high proportion of glycine residues, which can provide flexibility to protein structures, and charged amino acids near the C-terminus that might be involved in protein-protein interactions. MTH_1706 has the UniProt ID O27741, which can be used to access additional bioinformatic data . As an uncharacterized protein, it presents opportunities for novel discoveries regarding archaeal biology and protein function.

How is recombinant MTH_1706 typically produced for research purposes?

Recombinant MTH_1706 is produced using heterologous expression in E. coli, which provides a well-established system for producing archaeal proteins. The full-length protein (amino acids 1-105) is typically expressed with an N-terminal His-tag to facilitate purification via affinity chromatography . The heterologous expression in E. coli provides significant advantages for obtaining sufficient quantities of protein for biochemical and structural studies.

The production process typically involves cloning the MTH_1706 gene into an appropriate expression vector with a His-tag sequence, transformation into an E. coli expression strain, induction of protein expression, cell lysis, and purification using nickel affinity chromatography. After purification, the protein undergoes quality control testing, including SDS-PAGE analysis to confirm purity (>90% as reported) . The purified protein is then typically lyophilized for long-term storage and stability. This approach allows researchers to obtain high-quality protein samples suitable for a range of experimental applications.

What are the recommended conditions for storing and reconstituting MTH_1706?

MTH_1706 is supplied as a lyophilized powder, which provides stability during shipping and long-term storage. For optimal stability, the lyophilized protein should be stored at -20°C or -80°C upon receipt . Working aliquots can be stored at 4°C for up to one week to minimize freeze-thaw cycles, as repeated freezing and thawing is not recommended for maintaining protein integrity and activity .

For reconstitution, the protein vial should first be briefly centrifuged to bring the contents to the bottom. The protein should then be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage of reconstituted protein, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) and divide the solution into small aliquots before storing at -20°C or -80°C . This prevents repeated freeze-thaw cycles of the entire stock. The Tris/PBS-based buffer with 6% trehalose at pH 8.0 used in the storage formulation helps maintain protein stability during the lyophilization and reconstitution processes .

What approaches can be used to determine the function of the uncharacterized protein MTH_1706?

Determining the function of uncharacterized proteins like MTH_1706 requires a multi-faceted approach combining bioinformatic predictions, structural studies, and experimental validation. Sequence similarity searches against characterized proteins can provide initial clues, though these may be limited for archaeal proteins with low sequence conservation to better-studied organisms. Structural prediction tools and protein folding algorithms can potentially identify structural motifs conserved with proteins of known function, even when sequence similarity is low.

For experimental approaches, researchers should consider the membrane-associated nature of MTH_1706 based on its sequence. Localization studies using fluorescently tagged versions of the protein in model systems can confirm membrane association. Pull-down assays and co-immunoprecipitation experiments can identify potential protein interaction partners that may provide functional context. Additionally, gene knockout or knockdown studies in Methanothermobacter thermautotrophicus, if genetically tractable, can reveal phenotypic effects that suggest function. Activity-based proteomics approaches, where proteins are screened against a range of substrates or binding partners, can also be effective for functional discovery. These experimental approaches should be designed in a test matrix format, systematically varying key parameters to maximize the chances of functional discovery while minimizing experimental runs.

How can structural analysis of MTH_1706 contribute to functional characterization?

Structural analysis provides crucial insights for functional characterization, especially for uncharacterized proteins like MTH_1706. X-ray crystallography represents a gold standard approach, though it requires successful crystallization of the purified protein. For membrane-associated proteins like MTH_1706, specialized crystallization techniques such as lipidic cubic phase crystallization may be necessary. Cryo-electron microscopy (cryo-EM) offers an alternative approach that has revolutionized structural biology of membrane proteins and does not require crystallization.

Nuclear Magnetic Resonance (NMR) spectroscopy can provide structural information and also reveal dynamic aspects of the protein's behavior, including potential conformational changes upon substrate binding. For MTH_1706's size (105 amino acids), NMR is technically feasible and could provide valuable insights. Circular dichroism spectroscopy can determine secondary structure content (α-helices, β-sheets) and stability under various conditions, particularly relevant for a protein from a thermophilic organism. Once a structure is obtained, computational approaches such as molecular docking can predict potential binding sites and ligands. Structure comparison with known proteins using tools like DALI can identify structural similarities even when sequence similarity is low. A well-designed experimental approach might use a factorial design to systematically explore the effects of temperature, pH, and additives on structural stability, with each experiment rigorously controlled to ensure reliability of the structural data obtained.

What bioinformatic approaches are most effective for predicting the potential function of MTH_1706?

For uncharacterized archaeal proteins like MTH_1706, sophisticated bioinformatic analyses are essential starting points for functional prediction. Beyond basic BLAST searches, position-specific scoring matrices and hidden Markov models can detect remote homologies that simple sequence alignment might miss. Metagenomic context analysis, examining genes frequently co-located with MTH_1706 homologs across archaeal genomes, can suggest functional associations through the principle of guilt by association.

Advanced structural prediction tools like AlphaFold2 can generate high-confidence structural models that may reveal structural motifs associated with specific functions, even in the absence of significant sequence similarity to characterized proteins. Protein-protein interaction network analysis can place MTH_1706 in a functional context by predicting its interaction partners. Comparative genomics approaches, particularly analyzing gene conservation patterns across different archaeal species with varying metabolic capabilities, can narrow potential functional roles. Domain architecture analysis may identify conserved domains with known functions. Gene expression correlation analysis, examining which genes show similar expression patterns to MTH_1706 under different conditions, can provide additional functional clues. These bioinformatic approaches should be integrated rather than used in isolation, as convergent evidence from multiple predictive methods substantially increases confidence in functional hypotheses.

How should experiments be designed to investigate potential functions of MTH_1706?

Designing experiments to investigate potential functions of MTH_1706 requires careful planning following systematic experimental design principles. Begin by defining the problem clearly—what specific hypotheses about MTH_1706 function will be tested based on bioinformatic predictions . A literature survey on archaeal membrane proteins and Methanothermobacter thermautotrophicus biology will provide context and prevent duplication of existing research. Select variables to be measured based on the most likely functional categories (e.g., binding assays for transport function, enzymatic activity measurements if catalytic function is suspected).

A well-designed test matrix is critical for efficiency. For example, if investigating temperature dependence of a potential enzymatic activity, a full factorial design would test multiple temperature points (e.g., 40°C, 50°C, 60°C, 70°C) while systematically varying other relevant parameters like pH and substrate concentration . This approach is more efficient than varying one parameter at a time. For high-temperature assays appropriate for a thermophilic protein, specialized equipment and controls must be incorporated into the experimental design. As Taguchi noted, experiments in which only one parameter at a time is varied are inefficient, particularly when interaction exists between parameters . Use statistical methods to determine the minimum number of experimental runs needed while maintaining statistical power.

What controls are essential for experiments involving recombinant MTH_1706?

Positive controls are equally important; include well-characterized proteins with known activities similar to those hypothesized for MTH_1706. For binding assays, proteins with known binding properties should be tested in parallel. Temperature-related controls are particularly important when working with proteins from thermophilic organisms—experiments should include controls at both mesophilic and thermophilic temperatures to distinguish temperature-dependent effects. Specificity controls using related substrates or binding partners can determine selectivity of any observed activities. For recombinant proteins, it's essential to evaluate whether the His-tag affects function by comparing, when possible, tagged and untagged versions or proteins with differently positioned tags. Time-course controls can distinguish between initial rates and equilibrium measurements, which is particularly important for kinetic characterization.

What analytical methods are appropriate for tracking MTH_1706 activity in complex biological samples?

Tracking MTH_1706 in complex biological samples requires sensitive and specific analytical techniques. Immunological detection methods using antibodies raised against recombinant MTH_1706 provide high specificity, allowing Western blotting for detection in cell lysates or immunocytochemistry for localization studies. If antibodies are unavailable, the His-tagged version can be detected using anti-His antibodies .

Mass spectrometry-based proteomics offers powerful tools for detection and quantification of MTH_1706 in complex samples. Targeted approaches like Selected Reaction Monitoring (SRM) or Parallel Reaction Monitoring (PRM) can achieve high sensitivity by focusing on specific MTH_1706 peptides. Activity-based protein profiling might be applicable if specific enzyme activity is discovered. For potential membrane proteins like MTH_1706, detergent solubilization protocols must be optimized to maintain protein integrity during extraction from membranes. Comparative analysis between wild-type and MTH_1706 knockout strains (if available) using differential proteomics can reveal functional associations. For all these methods, appropriate calibration standards using purified recombinant MTH_1706 must be included to ensure accurate quantification. When designing analytical workflows, consider a test matrix approach to systematically optimize critical parameters such as extraction conditions, chromatographic separations, and detection methods.

How should researchers interpret potential membrane association of MTH_1706 based on sequence analysis?

Interpreting the membrane association potential of MTH_1706 requires careful analysis of hydrophobicity patterns in its sequence. The amino acid sequence ("MNARDKKFMTAGIIIALIIAVLAPFLASPNPDGLESTAEKVMPNPETEPVLESPLPDYTLPALGDSPFGGVVSMVIGTILVLAIAYGVGAVFRGRKAAGEEGGEE") contains multiple hydrophobic stretches that are characteristic of membrane-spanning domains. Particularly, the regions "IIIALIIAVLAPFLA" and "VIGTILVLAIAYGV" display strong hydrophobic character consistent with transmembrane helices.

Transmembrane prediction algorithms should be applied systematically to generate consensus predictions. These include TMHMM, Phobius, and MEMSAT, which use different algorithms and may produce slightly different results. A consensus approach combining multiple prediction methods increases confidence in the results. The charged residues at the C-terminus (RGRKAAGEEGGEE) might indicate an intracellular domain, following the positive-inside rule commonly observed in membrane proteins. When interpreting these predictions, researchers should consider that archaeal membrane proteins may have distinct characteristics from bacterial or eukaryotic ones, including differences in membrane composition (archaeal membranes contain ether-linked isoprenoid chains rather than ester-linked fatty acids). Experimental validation of these predictions is essential through techniques such as membrane fractionation studies, protease protection assays, or fluorescent protein tagging to determine orientation and localization.

How can researchers analyze potential thermostability properties of MTH_1706?

Analyzing the thermostability of MTH_1706 is particularly relevant given its origin from the thermophilic archaeon Methanothermobacter thermautotrophicus. Thermal shift assays (differential scanning fluorimetry) provide a straightforward approach to determine melting temperatures under various conditions. These assays can generate comparative data shown in table format:

Buffer ConditionpHSalt Concentration (mM)Melting Temperature (°C)
Phosphate6.0100Tm1
Phosphate7.0100Tm2
Tris8.0100Tm3
Tris8.0300Tm4

Circular dichroism spectroscopy at increasing temperatures can track unfolding transitions and changes in secondary structure elements. Activity assays (once a function is identified) at different temperatures can establish an optimal temperature range for function and determine the temperature at which activity is lost. Comparative analysis with homologous proteins from mesophilic organisms can identify sequence features associated with thermostability, such as increased proportion of charged residues, disulfide bonds, or decreased loop regions. Molecular dynamics simulations can provide theoretical insights into structural flexibility and stability at elevated temperatures. For all thermal stability analyses, it's critical to design a systematic test matrix varying temperature, pH, and buffer components to fully characterize the protein's behavior across different conditions.

How can contradictory results in MTH_1706 research be reconciled and analyzed?

Reconciling contradictory results is a common challenge in research with uncharacterized proteins like MTH_1706. When faced with conflicting data, begin with careful evaluation of methodological differences between studies. Variations in protein preparation methods, buffer compositions, or assay conditions can significantly impact results. Create a comparative table highlighting methodological differences between contradictory studies:

StudyExpression SystemPurification MethodBuffer CompositionAssay TemperatureResults
Study 1E. coli BL21(DE3)Ni-NTATris pH 8.0, 150mM NaCl37°COutcome 1
Study 2E. coli RosettaIMAC, Size ExclusionPhosphate pH 7.0, 100mM NaCl60°COutcome 2

Consider whether the recombinant protein construction differs between studies—for example, different tag positions or lengths might affect protein behavior. For an uncharacterized protein, apparent contradictions might actually reflect multiple functions or context-dependent behavior. Conduct replication studies that systematically vary conditions identified as potential sources of discrepancy. Collaborative cross-validation between research groups can help identify subtle methodological differences not apparent from published protocols. Meta-analysis approaches may help integrate contradictory findings into a more comprehensive model. Statistical analysis of contradictory results should consider sample sizes, statistical power, and effect sizes to determine the reliability of each finding. Following experimental design best practices , design confirmation experiments that specifically address the contradictions with appropriate controls.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.