Recombinant Methanothermobacter thermautotrophicus Uncharacterized protein MTH_215 (MTH_215)

Shipped with Ice Packs
In Stock

Description

Definition and Context

MTH_215 is a 204-amino acid protein from the thermophilic archaeon Methanothermobacter thermautotrophicus (formerly Methanobacterium thermoautotrophicum). It belongs to a class of uncharacterized proteins, indicating no confirmed functional role in cellular processes . The protein is part of the organism’s proteome, which has been studied for methane metabolism and membrane lipid modulation .

Research and Functional Insights

While MTH_215 remains uncharacterized, its presence in M. thermautotrophicus proteomic studies highlights its potential role in archaeal biology:

  • Proteomic Context: Proteomic analyses of M. thermautotrophicus identified 361 proteins (20% of the proteome), including uncharacterized complexes . MTH_215 was not explicitly linked to these complexes but may participate in broader cellular processes.

  • Pathway Associations: Creative BioMart lists MTH_215 in unspecified pathways, though no interacting partners or biochemical functions are documented .

Availability and Applications

Commercial suppliers offer MTH_215 in diverse formats:

SupplierProduct CodeKey Features
Creative BioMartRFL20693MFFull-length, His-tagged, E. coli expression
CusabioCSB-EP519652MSR1Partial, E. coli expression, >85% purity
CusabioCSB-YP519652MSR1Partial, Saccharomyces cerevisiae expression

Potential applications include:

  • Structural Studies: Crystallization or NMR for 3D structure elucidation.

  • Functional Screening: High-throughput assays to identify enzymatic or binding activities.

Gaps and Future Directions

MTH_215’s uncharacterized status underscores the need for:

  1. Biochemical Assays: Testing for catalytic activity (e.g., hydrolase, transferase).

  2. Protein Interaction Mapping: Identifying binding partners via co-IP or yeast two-hybrid .

  3. Genetic Knockout Studies: Assessing phenotypic effects in M. thermautotrophicus.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly include it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery details, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%. This can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MTH_215; Uncharacterized protein MTH_215
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)
Target Names
MTH_215
Target Protein Sequence
MMYKVRNMRETEVVISDKTANPAPLGLLGFGITTILLNLHNAGLFPINSMILAMGFAYGG IAQILASVMEYRKGNTFGTVAFGSYGLFWWSLVLLLVIPNLKFLETSGTAAASADPVAMA SYLFMWGLFTLLMFIATLKLKRGIQVIFISLAVLFFLLTAGEITGSALITAVAGYEGIFT GAAAMYVGLAEVINETHGRDILPT
Uniprot No.

Target Background

Database Links

KEGG: mth:MTH_215

STRING: 187420.MTH215

Protein Families
Acetate uptake transporter (AceTr) (TC 2.A.96) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanothermobacter thermautotrophicus and why is it significant for research?

Methanothermobacter thermautotrophicus is a thermophilic archaeon used as a model microbe for studying hydrogenotrophic methanogenesis - the conversion of hydrogen and carbon dioxide into methane. This organism is valuable for research due to its short doubling times and robust growth with high yields when cultivated under appropriate conditions . The thermophilic nature of this archaeon has made it particularly interesting for studying biochemical processes at high temperatures, and it has been extensively investigated for its metabolic pathways involved in methanogenesis over four decades . Scientists frequently use this organism to gain insights into energy and carbon metabolism in archaea, which has implications for both fundamental microbiology and biotechnological applications.

How is recombinant MTH_215 protein typically produced for research purposes?

Recombinant MTH_215 is typically produced using heterologous expression in Escherichia coli with an N-terminal His-tag for purification purposes . The methodological approach involves:

  • Cloning: The MTH_215 gene is amplified from M. thermautotrophicus genomic DNA and inserted into an expression vector compatible with E. coli.

  • Expression optimization: Because M. thermautotrophicus is an archaeon with different codon usage patterns than E. coli, codon optimization may be necessary. Expression conditions including temperature, induction time, and inducer concentration must be optimized.

  • Purification protocol:

    • Bacterial cell lysis under native or denaturing conditions

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Gel filtration for further purification if needed

    • Quality assessment via SDS-PAGE (>90% purity is typically achievable)

  • Protein recovery: The purified protein is typically obtained as a lyophilized powder after buffer exchange and lyophilization processes .

For researchers studying archaeal proteins, this heterologous expression system provides a practical approach despite the phylogenetic distance between the source organism and the expression host.

What storage and handling conditions are recommended for recombinant MTH_215?

Optimal storage and handling of recombinant MTH_215 requires careful attention to stability factors. The recommended conditions are:

Storage FormTemperatureBufferAdditional ComponentsNotes
Lyophilized powder-20°C to -80°CN/AN/AStore upon receipt
Reconstituted4°CTris/PBS-based buffer, pH 8.06% TrehaloseFor up to one week
Long-term storage-20°C to -80°CTris/PBS-based buffer, pH 8.05-50% glycerol (50% recommended)Aliquot to avoid freeze-thaw cycles

For reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL . The vial should be briefly centrifuged prior to opening to bring contents to the bottom. Repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and loss of activity . Researchers should prepare small working aliquots to minimize the need for repeated thawing of the main stock.

What genetic tools are available for studying proteins like MTH_215 in Methanothermobacter thermautotrophicus?

After decades of attempts, a comprehensive genetic system for Methanothermobacter species has been developed, offering new possibilities for studying proteins like MTH_215 in their native context. The modular Methanothermobacter vector system (pMVS) provides shuttle-vector plasmids with exchangeable selectable markers and replicons for both E. coli and M. thermautotrophicus . This system includes:

  • Selectable markers: A thermostable neomycin-resistance cassette that enables positive selection with neomycin in M. thermautotrophicus.

  • Replicons: The cryptic plasmid pME2001 from Methanothermobacter marburgensis serves as the replicon for M. thermautotrophicus, while standard E. coli replicons enable maintenance in that organism.

  • DNA transfer method: Interdomain conjugation from E. coli to M. thermautotrophicus, with specific adaptations to temperature, media, and headspace gas conditions during the spot-mating procedure.

  • Promoter options: Multiple promoters have been tested, including synthetic and native promoters, with significantly different expression levels observed .

This genetic system allows for several methodological approaches to study MTH_215, including:

  • Gene deletion or complementation studies

  • Controlled expression using characterized promoters

  • Reporter gene fusions to study expression patterns

  • Protein tagging for localization or interaction studies

These tools provide researchers with the means to investigate MTH_215 function through genetic manipulation in its native host, overcoming limitations of heterologous expression systems.

How can comparative genomics be utilized to predict the function of uncharacterized proteins like MTH_215?

Comparative genomics represents a powerful approach for generating functional hypotheses about uncharacterized proteins like MTH_215. Researchers should implement a multi-layered strategy:

  • Sequence-based analysis:

    • Homology searches against characterized proteins using BLAST, PSI-BLAST, and HHpred

    • Multiple sequence alignment of orthologous proteins from related archaea

    • Identification of conserved residues or motifs that might indicate function

  • Genomic context analysis:

    • Examination of adjacent genes in the M. thermautotrophicus genome, as functionally related genes are often clustered

    • Comparative analysis of gene neighborhoods across related species

    • Identification of conserved gene clusters that might indicate functional associations

  • Phylogenetic profiling:

    • Analysis of the distribution of MTH_215 orthologs across archaeal and bacterial species

    • Correlation with specific metabolic or physiological traits

  • Co-expression analysis:

    • If transcriptomic data is available, identification of genes co-expressed with MTH_215 under various conditions

    • Integration with pathway analysis to identify potential functional associations

The predicted transmembrane regions in MTH_215 suggest it may function as a membrane transporter or channel. Additional analysis of its sequence reveals potential structural similarity to other archaeal membrane proteins involved in ion or small molecule transport, which could guide experimental design for functional characterization.

What experimental approaches are recommended for determining the function of uncharacterized proteins like MTH_215?

Determining the function of uncharacterized proteins requires an integrated experimental approach:

ApproachMethodologyExpected OutcomeLimitations
Heterologous expressionExpression in E. coli with subsequent purification and biochemical assaysBiochemical properties and potential enzymatic activityMay not reflect native function/interactions
Genetic manipulationGene deletion or controlled expression in M. thermautotrophicus using pMVS system Phenotypic changes indicating physiological roleTechnical challenges with archaeal genetics
Protein localizationFusion with reporter proteins or epitope tagsSubcellular localization providing functional cluesPotential interference with native function
Interaction studiesPull-down assays, bacterial/archaeal two-hybrid systemsIdentification of protein partnersFalse positives/negatives
Structural studiesX-ray crystallography, cryo-EMStructural insights suggesting functionDifficulties in crystallizing membrane proteins
Metabolomic analysisComparison of wild-type vs. mutant strainsMetabolic changes indicating pathway involvementComplex data interpretation

For MTH_215 specifically, its putative transmembrane nature suggests focusing on:

  • Heterologous expression and reconstitution in liposomes to test for transport activity

  • Creation of deletion mutants using the newly developed genetic system for M. thermautotrophicus to observe growth phenotypes

  • Epitope tagging to confirm membrane localization

  • Metabolite profiling to identify potential substrates

These approaches should be conducted under various growth conditions relevant to M. thermautotrophicus, particularly focusing on temperature and substrate variations that might reveal condition-specific functions.

How can protein-protein interaction studies be designed for membrane proteins like MTH_215?

Investigating protein-protein interactions (PPIs) for membrane proteins like MTH_215 presents unique challenges due to their hydrophobic nature. A comprehensive experimental strategy should include:

  • In vivo crosslinking:

    • Chemical crosslinking in the native organism followed by immunoprecipitation

    • Label proteins with photoactivatable amino acid analogs for in situ crosslinking

    • Analyze crosslinked complexes by mass spectrometry to identify interaction partners

  • Split-protein complementation assays:

    • Adapt systems like split-GFP for use in archaeal hosts

    • Design constructs that account for the membrane topology of MTH_215

    • Use the pMVS shuttle vector system for co-expression of fusion proteins

  • Co-immunoprecipitation approaches:

    • Express tagged versions of MTH_215 in M. thermautotrophicus

    • Solubilize membrane complexes with appropriate detergents

    • Perform pull-down assays followed by mass spectrometry

  • Bacterial/archaeal two-hybrid systems:

    • Modify existing systems for compatibility with membrane proteins

    • Use truncated versions of MTH_215 that exclude transmembrane domains if necessary

When designing these experiments, researchers should consider the thermophilic nature of M. thermautotrophicus and ensure that interaction detection methods are compatible with elevated temperatures. Additionally, controls with known membrane protein interactions should be included to validate the experimental approach.

What are the key considerations for heterologous expression of thermophilic archaeal proteins like MTH_215?

Heterologous expression of thermophilic archaeal proteins presents several challenges that require methodological adaptations:

  • Expression host selection:

    • Standard E. coli strains may be suitable for initial attempts

    • Consider thermophilic bacterial hosts like Thermus thermophilus for proteins requiring higher temperatures for folding

    • Evaluate archaeal hosts like Sulfolobus solfataricus for proteins requiring archaeal-specific chaperones

  • Vector design optimization:

    • Codon optimization for the expression host

    • Selection of appropriate promoters (T7, tac, or thermostable alternatives)

    • Inclusion of solubility-enhancing fusion partners (MBP, SUMO, or thermostable alternatives)

    • Careful design of purification tags to minimize interference with protein function

  • Expression condition optimization:

    • Lower induction temperatures (15-25°C) to slow folding and increase solubility

    • Extended expression times to compensate for slower growth at lower temperatures

    • Testing multiple media compositions, particularly with osmolytes that might assist folding

  • Purification strategies:

    • Include stabilizing agents (glycerol, specific ions, mild detergents for membrane proteins)

    • Consider on-column refolding for proteins that form inclusion bodies

    • Thermal stability testing at various temperatures to determine optimal handling conditions

For MTH_215 specifically, expression in E. coli with an N-terminal His-tag has been successful , but researchers should consider testing multiple expression constructs with different tags and fusion partners to optimize yield and solubility.

How should experiments be designed to validate predicted functions of MTH_215?

Validating predicted functions of uncharacterized proteins like MTH_215 requires careful experimental design:

  • Hypothesis formulation:

    • Based on bioinformatic predictions and preliminary data

    • Consider multiple potential functions to test in parallel

    • Develop clear, testable predictions for each hypothesis

  • Genetic approach:

    • Generate knockout mutants using the pMVS system

    • Create complementation strains with wild-type and site-directed mutants

    • Design conditional expression systems to control protein levels

  • Biochemical validation:

    • Develop in vitro assays based on predicted functions

    • Purify recombinant protein under conditions that maintain native structure

    • Test activity under physiologically relevant conditions (temperature, pH, salt)

  • Controls and validation:

    • Include positive controls (proteins with known function in the same pathway)

    • Include negative controls (mutants of MTH_215 predicted to lack activity)

    • Validate findings with orthogonal methods

  • Physiological relevance:

    • Test function under multiple growth conditions

    • Link biochemical activity to cellular phenotypes

    • Consider the impact of protein localization on function

Given the membrane-associated nature of MTH_215, experiments should be designed to account for the challenges of working with membrane proteins, including appropriate detergent selection and consideration of the lipid environment.

What controls are necessary when studying an uncharacterized protein like MTH_215?

Rigorous experimental controls are essential when investigating uncharacterized proteins:

Control TypePurposeImplementation
Positive controlsValidate experimental systemsInclude well-characterized proteins with similar predicted functions
Negative controlsEstablish baseline and specificityUse buffer-only conditions, inactive mutants, or unrelated proteins
Expression controlsVerify protein productionWestern blotting, activity assays of known tag functions
Localization controlsConfirm proper cellular locationInclude proteins with known localization patterns
Specificity controlsDemonstrate selective activityTest related substrates or interaction partners
Technical replicatesAssess methodological variabilityRepeat experiments under identical conditions
Biological replicatesAccount for biological variabilityUse independent cultures or protein preparations

For MTH_215 specifically, given its expression in E. coli and purification via His-tag , controls should include:

  • Empty vector controls to account for host protein contamination

  • His-tagged control proteins to validate purification methods

  • Thermostability assays with known thermostable and mesophilic proteins

  • Membrane protein controls if studying membrane-associated functions

These controls help distinguish genuine biological findings from artifacts, particularly important when working with proteins from thermophilic archaea in heterologous systems.

How should researchers interpret contradictory data about MTH_215 function?

When confronted with contradictory data regarding MTH_215 function, researchers should employ a systematic analytical approach:

  • Methodological reconciliation:

    • Compare experimental conditions between contradictory studies

    • Evaluate differences in protein preparation, purity, and activity assays

    • Consider effects of tags, fusion partners, or expression systems

    • Assess the influence of buffer components, detergents, or stabilizing agents

  • Biological context analysis:

    • Consider if MTH_215 may have multiple functions depending on cellular conditions

    • Evaluate possible post-translational modifications affecting function

    • Assess potential differences in protein-protein interactions across experimental systems

    • Examine if contradictions arise from in vitro versus in vivo approaches

  • Technical validation:

    • Repeat key experiments using multiple methodologies

    • Collaborate with laboratories reporting different results to standardize approaches

    • Develop new assays that may resolve apparent contradictions

  • Theoretical integration:

    • Develop models that might explain seemingly contradictory results

    • Use computational approaches to test if different functional states are possible

    • Consider evolutionary context and function of homologs in related species

When publishing results, researchers should explicitly address contradictions in the literature and provide detailed methodological information to facilitate reproduction and validation by others in the field.

What bioinformatic approaches should be used to predict potential functions of MTH_215?

Comprehensive bioinformatic analysis of MTH_215 should integrate multiple computational approaches:

  • Sequence-based predictions:

    • PSI-BLAST and HHpred for distant homology detection

    • InterProScan for domain and motif identification

    • TMHMM and TOPCONS for transmembrane topology prediction

    • SignalP for signal peptide prediction

    • Analysis of sequence conservation patterns across orthologs

  • Structural predictions:

    • AlphaFold2 or RoseTTAFold for ab initio structure prediction

    • Comparison with known structures via DALI or TM-align

    • Binding site prediction using CASTp or SiteMap

    • Molecular dynamics simulations to assess stability and dynamics

  • Functional inference:

    • Gene Ontology term prediction using tools like DeepGOPlus

    • Metabolic pathway mapping using KEGG and BioCyc

    • Protein-protein interaction prediction using STRING or HIPPIE

    • Integration of predictions with experimentally determined archaeal interactomes

  • Evolutionary analysis:

    • Phylogenetic tree construction of MTH_215 homologs

    • Analysis of selection pressures using dN/dS ratios

    • Ancestral sequence reconstruction to identify evolutionarily conserved features

The results from these analyses should be integrated to generate testable hypotheses about MTH_215 function, with particular attention to predicted membrane localization and potential roles in transport or signaling suggested by its sequence characteristics.

How can researchers use the genetic systems developed for M. thermautotrophicus to study MTH_215 in vivo?

The recently developed genetic tools for M. thermautotrophicus provide powerful approaches for studying MTH_215 function in its native context:

  • Gene deletion or knockdown:

    • Use the pMVS shuttle vector system to create deletion constructs

    • Employ CRISPR-Cas9 adapted for thermophilic archaea

    • Analyze resulting phenotypes under various growth conditions

    • Complement with wild-type or mutant versions to confirm specificity

  • Protein tagging and localization:

    • Create C- or N-terminal fusions with thermostable fluorescent proteins

    • Use epitope tags for immunolocalization studies

    • Consider split-GFP approaches for minimizing functional disruption

    • Validate localization using membrane fractionation

  • Controlled expression:

    • Utilize characterized promoters of varying strengths as demonstrated for other genes

    • Create inducible expression systems adapted for M. thermautotrophicus

    • Monitor effects of MTH_215 overexpression or depletion

  • Reporter gene assays:

    • Fuse the MTH_215 promoter to reporter genes like thermostable β-galactosidase

    • Monitor expression under different growth conditions

    • Identify regulatory factors controlling MTH_215 expression

The interdomain conjugation protocol established for M. thermautotrophicus is particularly valuable, with specific adaptations to temperature, media, and headspace gas conditions during the spot-mating procedure being critical for success . Researchers should pay careful attention to these optimized conditions to achieve efficient genetic manipulation when studying MTH_215.

What are the most promising avenues for future research on MTH_215?

The uncharacterized nature of MTH_215 presents numerous opportunities for impactful research. The most promising directions include:

  • Comprehensive functional characterization:

    • Combine genetic approaches using the new M. thermautotrophicus tools with biochemical analysis

    • Investigate the role of MTH_215 in metabolic pathways related to methanogenesis

    • Explore potential membrane transport functions suggested by sequence analysis

  • Structural biology:

    • Determine the three-dimensional structure using X-ray crystallography or cryo-EM

    • Investigate protein dynamics using hydrogen-deuterium exchange or NMR

    • Use structure to inform functional hypotheses and guide mutagenesis

  • Systems biology integration:

    • Place MTH_215 in the context of the M. thermautotrophicus interactome

    • Identify metabolic or regulatory networks involving MTH_215

    • Compare function across different archaeal species to understand evolutionary conservation

  • Biotechnological applications:

    • Explore potential applications in bioenergy if related to methanogenesis

    • Investigate thermostable properties for industrial enzyme applications

    • Consider bioremediation applications if involved in substrate utilization

These research directions are now feasible due to the availability of both recombinant expression systems and genetic tools for the native host , providing complementary approaches to understanding this uncharacterized protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.