Recombinant Methanothermobacter thermautotrophicus Uncharacterized protein MTH_518 (MTH_518)

Shipped with Ice Packs
In Stock

Description

Introduction to Methanothermobacter thermautotrophicus and MTH_518

Methanothermobacter thermautotrophicus (formerly known as Methanobacterium thermoautotrophicum) is a thermophilic methanogenic archaeon originally isolated from sewage sludge in Urbana, Illinois, USA . The type strain, designated as Delta H (or DeltaH), is maintained in various culture collections including ATCC 29096, JCM 10044, and NBRC 100330 . This organism thrives in anaerobic conditions at elevated temperatures around 65°C and has been extensively studied for its ability to produce methane from carbon dioxide and hydrogen.

MTH_518 is one of many genes in the M. thermautotrophicus genome that encodes a protein with currently unknown function. Located within the complete genome sequence of M. thermautotrophicus Delta H, MTH_518 represents one of the numerous uncharacterized open reading frames (ORFs) that require further investigation to elucidate their biological roles .

Potential Functional Domains

While the specific function of MTH_518 remains unknown, sequence analysis suggests it may contain zinc-finger-like motifs characterized by the presence of cysteine residues in positions that could coordinate metal ions. These features are often associated with DNA-binding proteins, suggesting a potential role in gene regulation or DNA metabolism .

Expression Systems

The recombinant MTH_518 protein has been successfully expressed in Escherichia coli expression systems. The protein is typically produced with an N-terminal histidine tag (His-tag) to facilitate purification . The expression construct contains the full-length coding sequence (amino acids 1-111) of the native MTH_518 protein .

Purification Methods

Purification of the recombinant His-tagged MTH_518 protein is typically achieved through a combination of the following techniques:

  1. Immobilized metal affinity chromatography (IMAC) utilizing the His-tag

  2. Size exclusion chromatography for further purification

  3. SDS-PAGE analysis to confirm purity

The purified protein generally demonstrates a purity greater than 90% as determined by SDS-PAGE analysis .

Reconstitution Guidelines

For optimal reconstitution of lyophilized MTH_518 protein, the following procedure is recommended:

  1. Centrifuge the vial briefly before opening to collect contents at the bottom

  2. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (typically 50%)

  4. Aliquot for long-term storage at -20°C/-80°C

Sequence Homology

Sequence analysis has revealed that MTH_518 shares homology with certain bacterial proteins. Notably, the fjo9 gene product from Flavobacterium johnsoniae shows sequence similarity to MTH_518 . This cross-domain sequence conservation between Archaea (M. thermautotrophicus) and Bacteria (F. johnsoniae) suggests that MTH_518 may represent an ancient protein with evolutionarily conserved functions.

Genomic Context

Analysis of the genomic context of MTH_518 within the M. thermautotrophicus genome reveals that it is located among various genes of both known and unknown functions . The genomic neighborhood of MTH_518 could provide clues to its potential functional associations and biological roles.

Research Applications

While the specific function of MTH_518 remains to be fully elucidated, the availability of recombinant protein enables various research applications:

  1. Structural studies using X-ray crystallography or NMR spectroscopy

  2. Protein-protein interaction studies to identify binding partners

  3. Functional assays to determine enzymatic activities

  4. Antibody production for localization studies

  5. Comparative genomics and evolution studies

Potential Functional Roles

Based on sequence features and homology studies, several potential functions have been proposed for MTH_518:

  1. DNA binding and potential involvement in transcriptional regulation

  2. Membrane association, suggesting possible roles in membrane integrity or transport

  3. Metal ion binding, potentially functioning in detoxification or cofactor assembly

  4. Involvement in archaeal-specific metabolic pathways

Future Research Priorities

Several key areas warrant further investigation to better understand MTH_518:

  1. Determination of three-dimensional structure through crystallography or other structural biology methods

  2. Characterization of binding partners through pull-down assays and mass spectrometry

  3. Generation of knockout or knockdown mutants in M. thermautotrophicus to assess phenotypic effects

  4. Functional reconstitution studies to test specific biochemical activities

  5. Comparative analysis across archaeal species to determine conservation and variability

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MTH_518; Uncharacterized protein MTH_518
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)
Target Names
MTH_518
Target Protein Sequence
MVCMRFRYICHRKPERTFSFRGHYFPVCSRCTGIYLGAFTYFLYAFLIPVKYTAATVLLA LLLVIPTFIDGFTQLMGYRESNNVLRFSTGLPAGIGLAVLTKVLKHLILHI
Uniprot No.

Target Background

Database Links

KEGG: mth:MTH_518

STRING: 187420.MTH518

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for producing recombinant MTH_518?

E. coli is the predominant expression system used for recombinant MTH_518 production. When designing an expression strategy, researchers should consider:

  • Vector selection: pET expression vectors with T7 promoters provide high-level expression for His-tagged constructs

  • E. coli strain: BL21(DE3) or Rosetta strains are recommended as they are deficient in certain proteases and can accommodate codon bias

  • Induction conditions: IPTG concentrations of 0.5-1.0 mM at mid-log phase (OD600 of 0.6-0.8) with post-induction growth at 30°C for 4-6 hours typically yield good results

  • Solubility considerations: As a protein from a thermophilic organism, expression at higher temperatures (30-37°C) may improve proper folding

The recombinant protein is typically purified to >90% purity as determined by SDS-PAGE, with yields varying depending on expression conditions .

How should MTH_518 protein be stored to maintain stability?

Based on established protocols for similar recombinant proteins, MTH_518 requires specific storage conditions to maintain stability and activity:

Storage ConditionRecommendationPurpose
Short-term storage4°C for up to one weekPrevents protein degradation while maintaining accessibility
Long-term storage-20°C/-80°C with 50% glycerolPrevents freeze-thaw damage and protein denaturation
Buffer compositionTris/PBS-based buffer, pH 8.0 with 6% TrehaloseStabilizes protein structure
AliquotingMultiple small volumesAvoids repeated freeze-thaw cycles
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLEnsures proper protein concentration

Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity. It is recommended to centrifuge vials briefly before opening to bring contents to the bottom .

What is the recommended approach for designing experiments to characterize the function of MTH_518?

When approaching the functional characterization of an uncharacterized protein like MTH_518, a systematic experimental design is essential:

  • Sequence-based analysis: Begin with computational approaches like sequence homology, motif identification, and structural prediction to generate hypotheses about potential functions.

  • Between-subjects experimental design: When testing multiple experimental conditions (e.g., different buffer compositions, temperature ranges), assign each condition to separate sample groups to avoid carryover effects .

  • Random assignment: Implement random assignment when allocating samples to different experimental conditions to control for extraneous variables and prevent confounding factors .

  • Control selection: Include both positive controls (proteins with known function from the same organism) and negative controls (buffer-only or irrelevant protein controls) in all experiments.

  • Reproducibility verification: Design experiments with technical triplicates and biological replicates to ensure statistical validity and reproducibility of results.

This methodical approach follows established research design principles and provides a framework for rigorous scientific investigation of uncharacterized proteins like MTH_518 .

What purification methods are most effective for recombinant His-tagged MTH_518?

Purification of His-tagged MTH_518 can be accomplished using immobilized metal affinity chromatography (IMAC) following these methodological steps:

  • Cell lysis: Sonication or enzymatic lysis in a buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, and protease inhibitors.

  • IMAC purification:

    • Equilibrate Ni-NTA resin with lysis buffer

    • Incubate cleared lysate with resin for 1 hour at 4°C

    • Wash with increasing concentrations of imidazole (20-40 mM)

    • Elute with 250-300 mM imidazole

  • Secondary purification: Size exclusion chromatography (Superdex 75 or similar) to remove aggregates and obtain homogeneous protein.

  • Quality assessment: SDS-PAGE analysis to verify purity (>90%) and western blotting with anti-His antibodies to confirm identity .

  • Endotoxin removal: If the protein will be used in immunological studies, endotoxin removal using Triton X-114 phase separation or specialized endotoxin removal columns is recommended.

This purification workflow is based on established protocols for similar archaeal proteins and should yield highly pure, functional protein suitable for downstream applications.

How can circular dichroism (CD) be used to assess proper folding of recombinant MTH_518?

Circular dichroism spectroscopy is a valuable technique for assessing the secondary structure and proper folding of recombinant proteins:

  • Sample preparation:

    • Purify protein to >95% homogeneity

    • Prepare at 0.1-0.2 mg/mL in a low-salt buffer (e.g., 10 mM phosphate buffer, pH 7.5)

    • Filter through 0.22 μm filters to remove particulates

  • Data acquisition:

    • Far-UV CD spectrum (190-260 nm) for secondary structure assessment

    • Near-UV CD spectrum (250-320 nm) for tertiary structure fingerprinting

    • Temperature scans (25-95°C) to determine thermal stability

  • Data analysis:

    • Compare experimental spectrum with reference spectra for common secondary structures

    • Calculate percentages of α-helix, β-sheet, turns, and random coil

    • Compare with computational predictions based on sequence

  • Validation: Compare CD spectra under native and denaturing conditions (e.g., 8M urea) to verify that the native spectrum represents folded protein .

CD analysis can confirm whether the recombinant MTH_518 has attained proper secondary structure, which is particularly important for proteins from thermophilic organisms expressed in mesophilic hosts like E. coli .

What approaches can be used to identify potential binding partners and interaction networks of MTH_518?

Identifying interaction partners is crucial for understanding the function of uncharacterized proteins like MTH_518. Several complementary approaches can be employed:

  • Pull-down assays:

    • Use His-tagged MTH_518 as bait with Methanothermobacter thermautotrophicus lysate

    • Identify bound proteins by mass spectrometry

    • Verify interactions with reciprocal pull-downs

  • Yeast two-hybrid screening:

    • Create a cDNA library from M. thermautotrophicus

    • Screen against MTH_518 as bait

    • Validate positive interactions with alternative methods

  • Cross-linking coupled with mass spectrometry (XL-MS):

    • Incubate MTH_518 with cellular fractions and apply chemical cross-linkers

    • Digest and analyze by tandem mass spectrometry

    • Identify cross-linked peptides using specialized software

  • Surface plasmon resonance (SPR):

    • Immobilize purified MTH_518 on a sensor chip

    • Flow potential binding partners over the surface

    • Measure binding kinetics and affinity constants

  • Computational predictions:

    • Use protein-protein interaction prediction algorithms

    • Analyze co-evolution patterns across related species

    • Model potential interaction interfaces

When reporting interaction data, it's essential to distinguish between direct and indirect interactions, and to provide quantitative measures of interaction strength (KD values) .

How can researchers address apparent contradictions in experimental results when working with MTH_518?

Contradictory findings are common in research on uncharacterized proteins and require systematic analysis to resolve. When facing contradictory results with MTH_518, researchers should:

  • Categorize the nature of contradictions:

    • Internal to the experimental system (e.g., protein conformation, buffer conditions)

    • External factors (e.g., laboratory environment, reagent sources)

    • Endogenous vs. exogenous contexts (in vitro vs. in vivo results)

  • Examine experimental context differences:

    • Species variations and expression systems

    • Protein tags and their potential influence

    • Buffer composition and pH differences

    • Temperature and other physical parameters

    • Concentration-dependent effects

  • Implement systematic approach to resolve contradictions:

    Contradiction TypeInvestigation MethodAnalysis Approach
    Activity discrepanciesSide-by-side testing with controlled variablesStatistical comparison with appropriate tests
    Structural differencesMultiple structural techniques (CD, NMR, crystallography)Comprehensive structural analysis
    Localization conflictsTagged and untagged variants in multiple systemsQuantitative co-localization analysis
    Binding partner differencesStandardized binding assays with controlled conditionsNetwork analysis with confidence scoring
  • Document contextual details: When publishing findings, explicitly record all experimental conditions to help others interpret apparent contradictions in the literature .

This systematic approach can help distinguish true contradictions from context-dependent variations in experimental results.

What epitope mapping strategies are recommended for generating specific antibodies against MTH_518?

Developing specific antibodies against uncharacterized proteins requires careful epitope selection and validation:

  • Computational epitope prediction:

    • Analyze sequence for immunogenic regions using algorithms that predict:

      • Surface accessibility

      • Hydrophilicity

      • Flexibility

      • Secondary structure propensity

    • Select 2-3 regions with high predicted immunogenicity

  • Peptide synthesis approach:

    • Synthesize peptides (15-20 amino acids) corresponding to predicted epitopes

    • Conjugate to carrier proteins (KLH or BSA)

    • Immunize rabbits or mice following standard protocols

    • Validate antibody specificity against recombinant protein

  • Recombinant protein fragments:

    • Express discrete domains of MTH_518

    • Use for immunization and epitope mapping

    • Identify immunodominant regions

  • Validation methods:

    • ELISA against peptides and full-length protein

    • Western blot analysis with recombinant protein

    • Immunoprecipitation to confirm specificity

    • Cross-reactivity testing against related proteins

This approach mirrors successful epitope prediction strategies used for other archaeal proteins and can generate specific antibodies useful for localization and functional studies .

What statistical approaches are appropriate for analyzing MTH_518 experimental data?

  • Experimental design considerations:

    • Use between-subjects design when comparing different treatments or conditions

    • Implement random assignment to control for confounding variables

    • Include appropriate positive and negative controls

  • Recommended statistical tests:

    Data TypeAppropriate TestApplication
    Continuous data, normal distributionStudent's t-test (two groups) or ANOVA (multiple groups)Comparing expression levels or binding affinities
    Non-normally distributed dataMann-Whitney U test or Kruskal-WallisAnalysis of non-parametric data
    Categorical dataChi-square testAnalyzing localization patterns
    Correlational analysisPearson or Spearman correlationRelationship between expression and function
  • Multiple testing correction:

    • Use Bonferroni correction for small numbers of comparisons

    • Apply False Discovery Rate (FDR) methods for large-scale analyses

  • Sample size determination:

    • Conduct power analysis before experiments

    • Aim for 80-90% power to detect biologically relevant effects

  • Data presentation:

    • Use appropriate visualizations (bar charts for group comparisons, scatter plots for correlations)

    • Report both statistical significance and effect sizes

    • Include error bars representing standard deviation or standard error

Following these statistical principles ensures robust and reproducible analysis of MTH_518 experimental data.

How should researchers present complex data from MTH_518 structural and functional studies?

Effective data presentation is critical for communicating research findings:

These presentation strategies ensure that complex data from MTH_518 studies can be effectively communicated and interpreted by the scientific community.

What emerging technologies could advance our understanding of MTH_518 function?

Several cutting-edge technologies show promise for elucidating the function of uncharacterized proteins like MTH_518:

  • Cryo-electron microscopy (Cryo-EM):

    • Enables visualization of protein structure without crystallization

    • Particularly valuable for membrane-associated proteins

    • Can capture different conformational states

  • AlphaFold and other AI-based structure prediction:

    • Generate high-confidence structural models

    • Identify potential functional sites

    • Guide experimental design for functional studies

  • Proximity labeling techniques:

    • APEX2 or BioID fusion constructs to identify proximal proteins in vivo

    • Enables identification of transient interactions

    • Can be performed under native conditions

  • Single-molecule techniques:

    • FRET to detect conformational changes

    • Optical tweezers to measure mechanical properties

    • Super-resolution microscopy for localization studies

  • High-throughput functional screening:

    • CRISPR-based gene editing in archaeal systems

    • Synthetic genetic array analysis

    • Metabolomics profiling to detect altered metabolic patterns

  • In-cell NMR spectroscopy:

    • Study protein structure and dynamics in cellular environment

    • Detect ligand binding under physiological conditions

    • Monitor conformational changes in response to stimuli

Integrating these technologies with classical biochemical approaches will likely provide new insights into the function of MTH_518 and its role in Methanothermobacter thermautotrophicus biology.

How can researchers develop functional assays for an uncharacterized protein like MTH_518?

Developing functional assays for uncharacterized proteins requires a systematic approach:

  • Bioinformatic analysis-guided hypothesis generation:

    • Identify conserved domains and motifs

    • Search for distant homologs with known functions

    • Predict potential enzymatic activities based on key residues

  • Activity screening approaches:

    • Test for common enzymatic activities (hydrolase, transferase, etc.)

    • Screen against metabolite libraries

    • Assess binding to common cofactors and substrates

  • Phenotypic assays:

    • Overexpression and knockout/knockdown studies

    • Complementation of mutant strains

    • Stress response assessment

  • Structural approaches to function:

    • Identify potential ligand-binding pockets

    • Perform structure-based virtual screening

    • Use molecular dynamics simulations to predict functional motions

  • Functional assay development workflow:

    StageApproachOutcome
    Initial screeningBroad activity panelsNarrow potential functions
    Hypothesis refinementTargeted biochemical assaysConfirm specific activity
    ValidationMutagenesis of key residuesEstablish structure-function relationship
    Physiological relevanceIn vivo studiesConnect biochemical function to biological role
  • Collaborative approaches:

    • Engage specialists in archaeal biology

    • Utilize facilities with specialized equipment

    • Participate in structural genomics initiatives

This systematic approach can transform an uncharacterized protein like MTH_518 into one with well-defined functional properties and biological context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.