Recombinant Methanothermobacter thermautotrophicus UPF0059 membrane protein MTH_1812 (MTH_1812)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Methanothermobacter thermautotrophicus UPF0059 Membrane Protein MTH_1812

The recombinant Methanothermobacter thermautotrophicus UPF0059 membrane protein MTH_1812 (UniProt: O27840), also designated as mntP, is a transmembrane protein expressed in Escherichia coli via recombinant production. This 184-amino-acid protein is annotated as a putative manganese efflux pump and belongs to the UPF0059 family of uncharacterized proteins . Its full-length sequence includes a hydrophobic core structure typical of membrane-integrated proteins, with a predicted topology involving multiple transmembrane helices .

Gene and Sequence Information

AttributeDetail
Gene NamemntP
Locus TagMTH_1812
SynonymsUPF0059 membrane protein MTH_1812
AA SequenceMDLLSMVLIGVGLAMDAFSISVSRGLALHESETNYALISALSFGTFQAAMPVLGWVSGLEIQRLVSALAPWAAFILLLIIGLKMIYESLIMEEEEFIFSYRELLVLSIATSIDAFAVGVSFALLDISIWLPVIVIGLITFILSLAGSYIGERVGHIFENRLEALGGLILILIGLKILLENVSFT

The protein’s hydrophobic regions suggest a role in membrane integration, while its classification as a manganese efflux pump implies involvement in metal ion transport .

Membrane Dynamics in M. thermautotrophicus

Studies on Methanothermobacter thermautotrophicus ΔH reveal dynamic membrane lipid remodeling under stress conditions:

  1. Hydrogen Limitation: Increased polyprenol accumulation, potentially linked to pseudomurein synthesis and cell wall thickening .

  2. Nutrient Limitation: Elevated sodiated lipid adducts, suggesting ion retention mechanisms .

  3. Stationary Phase: Shift toward glycolipids (e.g., glycosyl archaeol) over phospholipids, enhancing membrane stability .

While MTH_1812’s direct role in these processes remains uncharacterized, its classification as a membrane protein positions it as a candidate for lipid transport or membrane remodeling .

Expression Optimization

Advances in E. coli expression systems, such as improved T7 promoter sequences and translation initiation regions (TIRs), have enhanced recombinant protein yields . For example:

  • T7 Promoter Restoration: Restoring the full T7 consensus sequence increased sfGFP production by 2–3 fold .

  • TIR Evolution: Synthetically evolved TIR variants boosted yields by up to 47-fold in sfGFP and 2–3 fold in human proteins like MTH1 .

These optimizations could theoretically improve MTH_1812 production, though strain-specific performance must be validated .

Experimental Uses

  • ELISA Assays: Partial MTH_1812 variants are used for antibody detection .

  • Structural Studies: Full-length MTH_1812 is critical for crystallization or cryo-EM analysis.

Limitations

  • Stability: Repeated freeze-thaw cycles degrade activity, necessitating aliquoting .

  • Expression Host: E. coli may not fully replicate archaeal post-translational modifications, potentially affecting native folding .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
mntP; MTH_1812; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)
Target Names
mntP
Target Protein Sequence
MDLLSMVLIGVGLAMDAFSISVSRGLALHESETNYALISALSFGTFQAAMPVLGWVSGLE IQRLVSALAPWAAFILLLIIGLKMIYESLIMEEEEFIFSYRELLVLSIATSIDAFAVGVS FALLDISIWLPVIVIGLITFILSLAGSYIGERVGHIFENRLEALGGLILILIGLKILLEN VSFT
Uniprot No.

Target Background

Function
This protein is likely involved in manganese efflux pump activity.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the general function of UPF0059 membrane proteins in archaea?

UPF0059 membrane proteins belong to a family of uncharacterized proteins found in archaea like Methanothermobacter thermautotrophicus. While their precise function remains under investigation, structural analysis suggests they play roles in membrane integrity or transport processes. Research approaches should begin with sequence analysis using homology modeling against known structures from the ExoIII family, as archaeal proteins often show functional similarities to bacterial counterparts while maintaining unique structural properties adapted to extreme environments . To further elucidate function, gene knockout studies paired with phenotypic characterization offer valuable insights into the protein's physiological role.

What expression systems are most effective for recombinant production of MTH_1812?

For archaeal membrane proteins like MTH_1812, Escherichia coli expression systems modified for thermophilic protein production offer a practical starting point. As demonstrated with other M. thermautotrophicus proteins, expression in E. coli mutant strains can produce functional proteins for further study . The methodology should include:

  • Codon optimization for E. coli expression

  • Use of thermostable tags that withstand purification conditions

  • Induction at lower temperatures (25-30°C) despite the thermophilic origin

  • Addition of specific chaperones to aid proper folding

Testing multiple constructs with varying N- and C-terminal regions is crucial, as membrane proteins often require optimization to maintain native conformation in heterologous systems.

What are the recommended methods for purifying recombinant MTH_1812?

Purification of archaeal membrane proteins requires specialized approaches. A methodological workflow should include:

  • Membrane fraction isolation using differential centrifugation

  • Detergent screening (typically starting with mild detergents like DDM or LDAO)

  • Immobilized metal affinity chromatography (IMAC) with heat treatment steps

  • Size exclusion chromatography for final polishing

The purification protocol should incorporate thermostability assays at each step, as proteins from M. thermautotrophicus typically show high thermal stability, which can be leveraged during purification to remove less stable contaminants . To determine optimal conditions, a systematic detergent screening approach should be employed, testing protein stability and monodispersity through analytical SEC and thermal shift assays.

How should researchers design experiments to characterize the membrane topology of MTH_1812?

Characterizing the membrane topology of MTH_1812 requires multiple complementary approaches:

TechniqueInformation ObtainedExperimental Considerations
Hydropathy analysisPrediction of transmembrane segmentsUse multiple algorithms (WHAT, TMHMM, Phobius)
Cysteine scanning mutagenesisExperimental verification of membrane-embedded regionsDesign systematic mutations throughout protein sequence
PhoA/GFP fusion analysisDetermination of cytoplasmic/extracellular domainsCreate truncation libraries with reporter fusions
Protease protection assaysVerification of exposed protein regionsUse vesicle reconstitution for native orientation
Cryo-EM or X-ray crystallographyHigh-resolution 3D structureRequires highly pure, stable protein preparation

When analyzing transmembrane segments, researchers should utilize the WHAT program for hydropathy plot generation, followed by AveHAS program analysis to compare topological predictions across multiple homologs . This multi-technique approach provides cross-validation of structural features and increases confidence in the proposed topology model.

What controls should be included when studying potential enzymatic activities of MTH_1812?

When investigating potential enzymatic activities of MTH_1812, a comprehensive control system is essential:

  • Negative controls should include heat-denatured MTH_1812 and a non-related membrane protein from M. thermautotrophicus expressed under identical conditions.

  • Positive controls should utilize well-characterized proteins with established functions from the same organism, such as Mth212, which demonstrates both AP-endonuclease and DNA uridine endonuclease activities .

  • Substrate specificity controls should test activity across a range of potential substrates to determine specificity profiles.

  • Activity assays should be performed across a temperature range (37-85°C) and pH range (5.5-8.5) to establish optimal conditions, reflecting the thermophilic and potentially pH-adaptive nature of archaeal proteins.

  • Metal ion dependency should be evaluated through EDTA chelation and subsequent reconstitution with various divalent cations, as many archaeal enzymes demonstrate unique metal cofactor requirements.

How can researchers determine the interaction partners of MTH_1812 in the native cellular environment?

Identifying interaction partners requires specialized approaches for archaeal membrane proteins:

MethodologyApplicationAdvantagesLimitations
Pull-down assays with thermostable tagsInitial screeningCan be performed under near-native conditionsMay identify non-specific interactors
Crosslinking mass spectrometryIn vivo interactionsCaptures transient interactionsRequires extensive validation
Bacterial/archaeal two-hybrid systemsBinary interactionsTests specific interactionsLimited by artificial expression system
Proximity labeling (modified BioID)In situ neighborhood mappingWorks with membrane proteinsRequires genetic modification of host
Co-immunoprecipitation with custom antibodiesValidation of specific interactionsConfirms interactions under native conditionsRequires development of specific antibodies

When analyzing mass spectrometry data from these experiments, researchers should apply stringent statistical filtering to distinguish true interactors from background contaminants. Cross-validation between multiple techniques provides the most reliable interaction networks . Thermostability of complexes should be evaluated, as M. thermautotrophicus proteins often form highly stable multimeric assemblies that resist conventional dissociation techniques.

What structural analysis techniques are most appropriate for MTH_1812, considering its membrane protein nature?

Structural characterization of MTH_1812 presents unique challenges due to its membrane localization:

For initial characterization, researchers should consider a hybrid approach combining computational modeling based on homologous structures with experimental validation through limited proteolysis and mass spectrometry mapping of accessible regions .

How should researchers address the challenges of functional characterization for a protein like MTH_1812 with no clear homologs in model organisms?

When working with archaeal proteins lacking clear homologs in model organisms, a comprehensive functional characterization workflow should include:

  • Genomic context analysis examining the operonic structure and co-evolved genes in M. thermautotrophicus and related archaea.

  • Comparative genomics across archaeal species to identify conserved genomic neighborhoods that might indicate functional relationships.

  • Phenotypic analysis of deletion mutants in M. thermautotrophicus (if genetic tools are available) or heterologous expression in model organisms followed by phenotypic screening.

  • Metabolomic profiling comparing wild-type and MTH_1812 knockout strains to identify affected metabolic pathways.

  • Substrate screening using activity-based protein profiling or thermal shift assays with compound libraries to identify potential ligands or substrates.

This approach has successfully identified functions for previously uncharacterized archaeal proteins, such as the Mth212 protein which was discovered to possess uridine endonuclease activity despite the absence of conventional uracil DNA glycosylases in M. thermautotrophicus .

What statistical approaches are recommended for analyzing experimental data related to MTH_1812 characterization?

Statistical analysis of experimental data for MTH_1812 should follow rigorous scientific standards:

Data TypeRecommended Statistical ApproachSignificance Criteria
Enzyme kineticsNon-linear regression, Michaelis-Menten or allosteric modelsR² > 0.95, residual analysis
Thermal stabilityBoltzmann sigmoid fitting, determination of Tm95% confidence intervals
Binding assaysScatchard plot analysis or non-linear curve fittingKd determination with standard error
Comparative expressionANOVA with appropriate post-hoc testsp < 0.05 with multiple testing correction
Structural comparisonsRMSD calculations, statistical coupling analysisStatistical significance of co-evolution

When presenting results, researchers should avoid qualitative descriptors like "remarkably decreased" or "extremely different" and instead rely on exact values to demonstrate the magnitude of effects . Data visualization should focus on highlighting key comparisons rather than overwhelming readers with excessive detail, following the principle: "Keep it simple. Present too much information tends to cloud the most pertinent facts that we wish to convey" .

How can researchers effectively handle contradictory results when characterizing novel proteins like MTH_1812?

When encountering contradictory results in MTH_1812 research:

When publishing such findings, researchers should transparently report contradictory results rather than selectively presenting only consistent data, as these contradictions often lead to important new discoveries about protein function and regulation.

How should researchers compare MTH_1812 with homologous proteins from other archaeal species?

Comparative analysis of MTH_1812 with homologs requires a structured approach:

This comparative approach has proven valuable for understanding the functional evolution of archaeal proteins, as demonstrated with the ExoIII family protein Mth212, which acquired unique uridine endonuclease activity absent in homologs from E. coli, H. sapiens, and M. mazei .

What methodologies are recommended for studying potential adaptations of MTH_1812 to the thermophilic environment of M. thermautotrophicus?

To understand thermoadaptation in MTH_1812:

Research ApproachKey ParametersExpected Findings
Comparative sequence analysisAmino acid composition biasesHigher frequency of charged/hydrophobic residues
Thermal stability assaysMelting temperature (Tm) determinationSignificantly higher Tm compared to mesophilic homologs
Structural rigidity analysisHydrogen bond and salt bridge networksIncreased electrostatic interactions stabilizing structure
Activity temperature profilingTemperature optima and activity rangeBroad high-temperature activity window
Molecular dynamics simulationsProtein flexibility at different temperaturesReduced flexibility at physiological temperature

When conducting heterologous expression, researchers should note that thermostable proteins often fold poorly at mesophilic temperatures and may require expression at elevated temperatures or in specialized host systems. The thermostability of archaeal membrane proteins can be leveraged during purification to remove less stable contaminants through heat treatment steps , a technique particularly valuable for proteins from hyperthermophiles like M. thermautotrophicus.

What are the key outstanding questions regarding MTH_1812 that require further investigation?

Despite advances in archaeal protein research, several critical questions about MTH_1812 remain unresolved:

  • The precise physiological function of MTH_1812 in M. thermautotrophicus cellular processes requires comprehensive characterization through genetic approaches and phenotypic analysis.

  • The structural basis for thermostability and potential functional adaptation to extreme environments needs detailed investigation through comparative structural biology.

  • The regulatory mechanisms controlling MTH_1812 expression under different environmental conditions remain largely unexplored.

  • The potential role of MTH_1812 in archaeal-specific cellular processes that lack direct counterparts in bacteria or eukaryotes represents an important frontier in archaeal biology.

  • The evolutionary trajectory of the UPF0059 protein family and how structural diversification relates to functional specialization across archaeal lineages presents an intriguing evolutionary question.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.