Recombinant Methylacidiphilum infernorum NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements you may have. Please indicate your preference in the order notes section, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Minf_2214; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Methylacidiphilum infernorum (isolate V4) (Methylokorus infernorum (strain V4))
Target Names
nuoK
Target Protein Sequence
MHIGLTHYVVASGILFAIGLAGIILRRDLIVILMCLEIMLNAANLALVAFSRFNANLLGQ VLVFFVITVAAAEVAVGLALIVALYRVKHTTKAEDITMLKF
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction with proton translocation (four hydrogen ions translocated across the cytoplasmic membrane for every two electrons transferred), thus conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Methylacidiphilum infernorum and why is it significant for biochemical research?

Methylacidiphilum infernorum is an extremely acidophilic methanotrophic aerobic bacterium first isolated and described in 2007 from soil and sediment at Hell's Gate, New Zealand, with similar organisms isolated from geothermal sites in Italy and Russia . As a polyextremophile, it grows optimally at pH between 2.0 and 2.5 and temperatures of 60°C, consuming methane at concentrations of 25% (v/v) in air and requiring approximately 8% (v/v) CO₂ for optimal growth . M. infernorum is classified within the phylum Verrucomicrobiota, making it unique among known methanotrophs due to its extreme acidophilic phenotype . This organism presents a valuable model for studying adaptations to extreme environments and novel metabolic pathways for methane utilization.

What functional role does nuoK play in bacterial metabolism?

NuoK functions as part of the NADH-quinone oxidoreductase complex (EC 1.6.99.5), also known as Complex I or NADH dehydrogenase I . This complex is central to respiratory electron transport, catalyzing the transfer of electrons from NADH to quinones (likely menaquinones in M. infernorum) and coupling this process to proton translocation across the membrane . The complex generates proton motive force that drives ATP synthesis. In M. infernorum specifically, Complex I may function bidirectionally, operating in reverse under certain conditions to generate NADH through an energy-dependent reverse electron flow mechanism .

How should recombinant M. infernorum nuoK be stored for maximum stability?

For optimal stability, recombinant M. infernorum nuoK should be stored in a Tris-based buffer containing 50% glycerol . For short-term storage (up to one week), working aliquots can be maintained at 4°C . For extended storage periods, the protein should be kept at -20°C or -80°C . It is important to avoid repeated freeze-thaw cycles as these can significantly compromise protein integrity and activity . When preparing working solutions, consider dividing the stock into single-use aliquots to prevent degradation from multiple freeze-thaw events.

What expression systems are optimal for producing functional recombinant nuoK?

Based on the complex membrane-associated nature of nuoK, specialized expression systems that accommodate membrane protein production are recommended. While E. coli-based systems may serve as a starting point, they often require optimization for membrane proteins. Consider using strains with enhanced membrane protein expression capabilities (such as C41/C43 or Lemo21) and employing fusion tags that aid in membrane targeting and solubility. Expression temperature should be carefully optimized, generally lower than standard conditions (16-18°C) to allow proper folding. For this extremophilic protein, expression systems capable of accommodating acidic conditions might improve proper folding and function.

What assays can verify the functional activity of recombinant nuoK?

To verify functional activity of recombinant nuoK, researchers should examine its integration into the complete NADH-quinone oxidoreductase complex, as the subunit alone would not exhibit catalytic activity. Functional assays should include:

  • Reconstitution assays: Incorporate the protein into proteoliposomes with other Complex I subunits

  • NADH oxidation assays: Measure spectrophotometric changes at 340 nm when complete Complex I (including nuoK) oxidizes NADH

  • Proton translocation assays: Using pH-sensitive fluorescent probes to detect proton pumping activity

  • Menaquinone reduction assays: Monitoring the reduction of quinone analogs in the presence of NADH

The unique physiology of M. infernorum suggests conducting these assays under acidic conditions (pH 2.0-2.5) and elevated temperatures (50-60°C) to better reflect the protein's native environment .

How does nuoK contribute to reverse electron flow in M. infernorum?

In M. infernorum, Complex I (which includes nuoK) participates in a unique metabolic arrangement that enables reverse electron flow under certain growth conditions. Model simulations predict that when H₂ is oxidized predominantly by periplasmic hydrogenases (HYD4pp), Complex I must operate in reverse to generate sufficient NADH for cellular processes . This reverse operation becomes necessary when approximately 76% or more of the H₂ flux is oxidized through HYD4pp .

NuoK, as an integral membrane subunit of Complex I, likely participates in the proton translocation channel that functions bidirectionally during normal and reverse electron transport. During reverse electron flow, the complex consumes proton motive force to drive electrons against their thermodynamically favorable direction, thereby producing NADH from NAD⁺. This process is especially important under autotrophic growth conditions where NADH production through conventional pathways may be limited .

What adaptations in nuoK structure might enable function in extreme acidic conditions?

The NADH-quinone oxidoreductase subunit K from M. infernorum likely contains several acidophilic adaptations that enable function at pH 2.0-2.5. These may include:

  • Increased proportion of acidic residues on the protein surface to maintain negative charge at low pH

  • Reduced number of pH-sensitive catalytic residues (histidines) that might become protonated in acidic conditions

  • Structural modifications in proton channels to maintain directionality of proton flow despite the extreme pH gradient

  • Enhanced hydrophobic interactions and salt bridges to maintain structural integrity

These adaptations would represent specialized evolutionary solutions for energy conservation in extreme environments, making this protein particularly interesting for studies on protein stability and function under harsh conditions.

How does nuoK integrate into the unique methylotrophic pathways of M. infernorum?

M. infernorum employs distinctive methylotrophic pathways that differ from other methanotrophs. Genome analysis indicates that while the organism encodes methane monooxygenase enzymes, it lacks known genetic modules for methanol and formaldehyde oxidation, suggesting a novel methylotrophic pathway . The nuoK protein, as part of the NADH-quinone oxidoreductase complex, plays a critical role in this specialized metabolism by:

  • Facilitating electron transfer from primary dehydrogenases to the quinone pool

  • Contributing to energy conservation through proton translocation

  • Potentially participating in reverse electron flow when required

The metabolic modeling of Methylacidiphilum species (model iAS473) reveals several important interactions where Complex I (including nuoK) interfaces with methane metabolism . Under methanotrophic conditions, electrons for methane oxidation originate from the quinone pool, with menaquinones serving as electron donors to the particulate methane monooxygenase (pMMO) . This creates a complex electron flow network where nuoK's function is integrated with methane oxidation pathways unique to this organism.

What are common challenges in purifying functional recombinant nuoK?

Purification of membrane proteins like nuoK presents several challenges:

ChallengeSolution Strategy
Poor solubilizationTest multiple detergents (DDM, LDAO, digitonin) at various concentrations
Protein instability at neutral pHMaintain acidic conditions (pH 2.0-3.0) throughout purification
Aggregation during concentrationAdd glycerol (10-20%) and keep protein concentration below 2 mg/mL
Loss of native lipid interactionsConsider styrene-maleic acid lipid particles (SMALPs) for extraction
Thermal instabilityPerform purification at room temperature for this thermophilic protein

Additionally, consider using a mild purification approach that maintains the integrity of the entire Complex I, as individual subunits may be unstable when isolated from their native complex. Expression with appropriate fusion tags (such as His6 or Strep-tag) can facilitate purification while minimizing disruption to protein structure.

How can researchers overcome expression challenges for this extremophilic protein?

Expression of functional M. infernorum nuoK requires strategies to accommodate its extremophilic nature:

  • Codon optimization: Adapt the coding sequence to the expression host while preserving critical features

  • Induction conditions: Use lower IPTG concentrations (0.1-0.3 mM) and longer induction periods at reduced temperatures

  • Host selection: Consider hosts with enhanced capacity for membrane protein expression or extremophilic expression hosts

  • Fusion partners: Test various fusion partners that enhance membrane targeting and folding (MBP, SUMO, Mistic)

  • Chaperone co-expression: Include chaperone proteins that aid in proper folding of complex membrane proteins

When expressing components of multisubunit complexes like NADH-quinone oxidoreductase, co-expression of interacting subunits may improve stability and yield of the target protein. For nuoK specifically, expression alongside neighboring subunits in the Complex I architecture might improve proper folding and stability.

What controls should be included when studying electron transport through reconstituted systems containing nuoK?

When investigating electron transport in reconstituted systems containing nuoK, include these essential controls:

  • Proteoliposomes without nuoK to establish baseline proton leakage and non-specific electron transport

  • Systems with known inhibitors of Complex I (rotenone, piericidin A) to confirm specific activity

  • pH controls spanning 2.0-7.0 to assess pH-dependent activity changes

  • Temperature controls (25°C vs. 60°C) to evaluate thermostability and optimal activity conditions

  • Electron donor/acceptor concentration series to establish kinetic parameters

Additionally, carefully monitor the proton gradient using pH-sensitive probes or fluorescent dyes to ensure the reconstituted system accurately represents the native environment. When studying reverse electron flow, controls with uncouplers (CCCP, valinomycin/nigericin) will help distinguish proton-driven activities from other electron transfer processes.

How might structural studies of nuoK inform the design of biocatalysts for extreme environments?

Detailed structural characterization of nuoK could provide valuable insights for engineering biocatalysts capable of functioning in extreme conditions. Cryo-electron microscopy of the intact Complex I containing nuoK, combined with molecular dynamics simulations under acidic conditions, would reveal stabilizing interactions that maintain function at low pH and high temperatures. These structural principles could then be applied to design industrial enzymes with enhanced stability for bioremediation of acidic environments, methane capture technologies, or biofuel production systems that operate under harsh conditions.

What potential applications exist for engineered versions of nuoK in synthetic biology?

The unique properties of nuoK from an extremophilic organism present several opportunities for synthetic biology applications:

  • Development of acid-resistant electron transport components for microbial fuel cells

  • Engineering synthetic methylotrophy in industrial production strains

  • Creation of pH-resistant proton-pumping modules for synthetic ATP production systems

  • Design of thermostable membrane protein scaffolds for controlled electron transport

Research focusing on the minimal functional units and critical residues in nuoK could enable modular approaches to bioengineering energy transduction systems with enhanced stability and efficiency in non-standard conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.