Recombinant Methylacidiphilum infernorum Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Description

Introduction to Methylacidiphilum infernorum and Potassium-Transporting ATPase

Methylacidiphilum infernorum is an extremely acidophilic methanotroph, meaning it thrives in highly acidic environments and utilizes methane as its primary carbon source . It belongs to the Verrucomicrobia phylum and exhibits unique metabolic and genetic characteristics adapted for survival in such extreme conditions . The genome of M. infernorum has been fully sequenced, revealing a streamlined structure with adaptations for acidic environments, including a shift in the isoelectric points of its proteins .

Potassium-transporting ATPases are essential enzymes found in various organisms, responsible for maintaining potassium ion gradients across cell membranes . These ATPases typically consist of multiple subunits, with the KdpC subunit being a component of the Kdp system, a high-affinity potassium uptake system .

Recombinant KdpC: Function and Structure

Recombinant KdpC refers to the KdpC subunit of the potassium-transporting ATPase that is produced using recombinant DNA technology . This involves cloning the gene encoding KdpC from Methylacidiphilum infernorum into a suitable expression vector and producing the protein in a host organism such as E. coli . The recombinant protein can then be purified and studied to understand its function and structure.

While specific structural details and research findings focused solely on the recombinant Methylacidiphilum infernorum KdpC are not readily available, the function of KdpC can be inferred from studies on homologous proteins in other organisms:

Genomic Context and Characteristics of Methylacidiphilum infernorum

Table 1. Genomic Features of Methylacidiphilum infernorum V4

FeatureMethylacidiphilum infernorum V4
Genome size2,287,145 bp
G+C content45.5%
Protein coding genes (CDSs)2473
Average size of CDSs, bp841
Percentage coding, %91.2%
Proteins with known biological function1522 (61%)
Proteins assigned to COGs1542 (62%)
Hypothetical proteins (no similarity to any proteins)731
tRNA46
rRNA (23S, 16S, and 5S)1 operon
Small RNA3
Riboswitches2
CRISPR repeats25
Transposons~9
Possible integrated plasmidMinf_1152 – Minf_1200

The genome analysis indicates that M. infernorum has a streamlined genome and has acquired numerous genes, including those for enzymes of methylotrophic pathways via horizontal gene transfer, particularly from Proteobacteria .

Metabolic Pathways and Adaptations

Methylacidiphilum infernorum exhibits unique adaptations in its central metabolism to thrive in acidic environments . It can fix ammonia through both glutamine synthesis and carbamoyl-phosphate synthesis reactions . The central metabolism is highly interconnected, featuring autotrophic pathways and modifications of C1-utilization pathways compared to other known methylotrophs .

Relevance to Acidophilic Adaptation

The study of KdpC in Methylacidiphilum infernorum is significant for understanding how organisms adapt to extremely acidic conditions . Acidophiles often require specialized mechanisms to maintain intracellular pH and ion homeostasis . The potassium transport system, of which KdpC is a part, likely plays a critical role in maintaining proper ion balance within the cell, thus enabling survival in these harsh environments .

Future Research Directions

Future research on recombinant Methylacidiphilum infernorum KdpC could include:

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your application.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; Minf_0033; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Methylacidiphilum infernorum (isolate V4) (Methylokorus infernorum (strain V4))
Target Names
kdpC
Target Protein Sequence
MKIFSLLILSLKITFLLTLLLGGLYPLAVFIVGKIFFPYQSEGSLIKDATGNVIGSALIG QKFDSPWYFHSRPSASDYDGLSSGGSNLAPSSLALIDTLRERTLRYRKENALSPTTPVPS DAVCASASGLDPHISFENGLLQVPRVAHERKADPKSIEELLRKHTEAPTWGILGERVVNV LLLNLELDKRYPKKIGY
Uniprot No.

Target Background

Function
This recombinant Methylacidiphilum infernorum Potassium-transporting ATPase C chain (KdpC) is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis coupled with the electrogenic transport of potassium ions into the cytoplasm. KdpC functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATPase subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.
Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Methylacidiphilum infernorum and why is it significant in microbiology?

Methylacidiphilum infernorum is an extremely acidophilic methanotrophic aerobic bacterium first isolated from the Hell's Gate geothermal area in New Zealand. Similar organisms have been independently isolated from geothermal systems in Italy and Russia . This microorganism belongs to the Verrucomicrobiota phylum, making it unique among all known methanotrophs . M. infernorum is a polyextremophile that grows optimally at pH between 2.0 and 2.5 and at temperatures of approximately 60°C . It represents the first described non-proteobacterial aerobic methane oxidizer, challenging previous assumptions about the phylogenetic distribution of methanotrophy .

The significance of this organism extends beyond its extremophilic nature. Genomic analysis reveals that it possesses a streamlined genome of 2,287,145 base pairs with distinct adaptations for life in harsh environments, including a major upward shift in the isoelectric points of proteins to function under acidic conditions . The organism also demonstrates unusual metabolic pathways, particularly for methane oxidation, which do not originate from horizontal gene transfer from proteobacteria as previously thought for methanotrophic capabilities .

What is the role of the Potassium-transporting ATPase system in bacterial physiology?

The Potassium-transporting ATPase system (Kdp) functions as a high-affinity potassium uptake system critical for maintaining intracellular potassium homeostasis under potassium-limited conditions. In bacterial physiology, potassium is essential for regulating cytoplasmic pH, maintaining cell turgor, and serving as a cofactor for various enzymes. The Kdp system typically consists of four components: KdpA (the potassium-binding subunit), KdpB (the catalytic subunit with ATPase activity), KdpC (the regulatory subunit that connects KdpA and KdpB), and KdpF (a small regulatory peptide).

In extremophiles like M. infernorum, the Kdp system likely plays a particularly crucial role in maintaining cellular homeostasis under the dual stresses of high temperature and extreme acidity. The system represents one of several adaptation mechanisms observed in M. infernorum, which has developed specialized molecular machinery to survive in its challenging habitat. The organism possesses distinct ATPase systems, including two operons encoding different H+ translocating F-ATPases - one similar to those found in other Verrucomicrobia and another resembling those found in gamma-proteobacteria .

How does the genomic context of kdpC in M. infernorum compare to other bacterial species?

The genomic organization of the kdp operon in M. infernorum reflects its unique evolutionary history. While the specific kdp operon isn't directly detailed in the available search results, M. infernorum's genome demonstrates considerable gene flux dominated by gene loss (526 genes inferred to have been lost and 262 gained) compared to the last common ancestor of all bacteria . This dynamic genome appears to have undergone extensive horizontal gene exchange with various bacteria, particularly Proteobacteria .

Similar to the differential organization observed in its ATPase operons (where one follows the verrucomicrobial arrangement atpBEFHAGDC and the other follows a gamma-proteobacterial-like arrangement atpDCQBEF:HAG) , the kdp system likely shows unique genomic context compared to mesophilic bacteria.

What expression systems are most suitable for producing recombinant kdpC from M. infernorum?

When expressing recombinant proteins from extremophiles like M. infernorum, selection of an appropriate expression system is critical due to the unique properties of these proteins. For the kdpC from M. infernorum, several expression systems warrant consideration:

  • E. coli-based systems with temperature induction: Given M. infernorum's thermophilic nature, expression systems that allow for elevated temperature induction (30-42°C) may help in proper folding while avoiding inclusion body formation. The pET series vectors with T7 promoters provide tight regulation and high expression levels suitable for initial screening.

  • Extremophilic expression hosts: Expression in moderate thermophiles like Thermus thermophilus or acidophiles like Acidithiobacillus ferrooxidans might provide cellular machinery more compatible with proper folding of M. infernorum proteins.

  • Chaperone co-expression systems: Co-expression with chaperones like GroEL/GroES can significantly improve folding of thermophilic proteins in mesophilic hosts.

  • Cell-free protein synthesis: For difficult-to-express membrane proteins like kdpC, cell-free systems offer advantages in avoiding toxicity issues and allowing direct incorporation into artificial membrane environments.

The selection should consider that M. infernorum proteins have undergone a major upward shift in isoelectric points as an adaptation to acidic conditions , which may affect solubility and folding in standard expression systems.

How do the structural adaptations of M. infernorum kdpC contribute to its function under extreme acidic and high-temperature conditions?

The structural adaptations of M. infernorum kdpC represent specialized evolutionary solutions to the dual challenges of extreme acidity (pH 2.0-2.5) and high temperature (60°C). While specific structural details of kdpC aren't directly provided in the search results, analysis of M. infernorum's general protein adaptations reveals several likely mechanisms:

  • Shifted isoelectric points: M. infernorum demonstrates a major upward shift in the isoelectric points of its proteins as an adaptation to acidic conditions . For kdpC, this likely manifests as an increased proportion of basic amino acids on solvent-exposed surfaces, allowing the protein to maintain appropriate charge distribution and stability at low pH.

  • Thermostability mechanisms: As a thermophilic protein, M. infernorum kdpC likely incorporates several features common to thermostable proteins, including:

    • Increased number of salt bridges and hydrogen bonds

    • Higher proportion of charged amino acids versus polar, uncharged residues

    • Reduced surface loop regions susceptible to thermal motion

    • Potentially increased hydrophobic core packing

  • Membrane-protein interface adaptations: The kdpC protein interacts with both KdpB and the cell membrane. In M. infernorum, these interactions likely feature specialized adaptations to maintain integrity in a proton-rich environment while withstanding thermal motion at elevated temperatures.

These adaptations collectively enable kdpC to maintain its critical regulatory function within the Kdp complex under conditions that would denature proteins from mesophilic organisms.

What are the methodological challenges in purifying functional recombinant M. infernorum kdpC and how can they be addressed?

Purifying functional recombinant M. infernorum kdpC presents several methodological challenges stemming from its extremophilic origin and membrane-associated nature. Addressing these challenges requires specialized approaches:

  • Solubility and stability issues:

    • Challenge: The shifted isoelectric point of M. infernorum proteins may cause aggregation under standard purification conditions.

    • Solution: Employ acidic buffers (pH 4-5) during initial purification steps, with careful pH transitions. Include stabilizing agents like glycerol (10-20%) and specific ions (K+, Mg2+) that might be cofactors.

  • Maintaining native conformation:

    • Challenge: As part of a multi-subunit membrane complex, isolated kdpC may adopt non-native conformations.

    • Solution: Consider co-expression with KdpB or use of nanodisc technology to provide a native-like membrane environment during purification.

  • Temperature considerations:

    • Challenge: Standard purification procedures at 4°C may induce cold-denaturation in thermophilic proteins.

    • Solution: Perform critical purification steps at moderate temperatures (20-30°C) to maintain native folding.

  • Functional validation:

    • Challenge: Confirming functionality of isolated kdpC is difficult as it functions as part of a complex.

    • Solution: Develop interaction assays with KdpB and biophysical methods to assess conformational integrity under varying conditions.

The purification strategy might benefit from insights gained from M. infernorum's dual ATPase systems, where distinct H+-translocating F-ATPases serve potentially different functions in energy generation versus pH homeostasis .

How does the kdpC subunit interact with other components of the potassium transport system in the context of M. infernorum's unique membrane composition?

The interaction between kdpC and other components of the potassium transport system in M. infernorum likely reflects adaptations to the organism's unique membrane composition, which must maintain integrity under both acidic and high-temperature conditions.

While specific details about these interactions aren't directly provided in the search results, we can infer several key aspects based on M. infernorum's physiology and comparative analysis with other ATPase systems found in this organism:

  • Regulatory interface with KdpB: The kdpC subunit typically serves as a critical regulatory interface with the catalytic KdpB subunit. In M. infernorum, this interface likely incorporates additional electrostatic interactions to maintain stability under extreme conditions, similar to adaptations observed in its other ATPase systems .

  • Membrane interaction specializations: M. infernorum's membrane must withstand extreme acidity and high temperatures, suggesting modifications in lipid composition. The kdpC-membrane interaction likely features specialized hydrophobic matching and interfacial electrostatic properties to function within this modified membrane environment.

  • Integration with other homeostasis systems: M. infernorum possesses two distinct H+ translocating ATPase systems - one verrucomicrobial-like and one gamma-proteobacterial-like . It has been hypothesized that while one system (F-ATPase) may focus on ATP synthesis, the other (N-ATPase-like) could maintain pH homeostasis . The kdp system likely coordinates with these systems, particularly under varying potassium and pH conditions.

  • Structural accommodations for thermal stability: The protein-protein interfaces within the Kdp complex likely feature enhanced hydrophobic interactions and salt bridges to maintain quaternary structure at 60°C, the optimal growth temperature for M. infernorum .

These specialized interactions ensure that the potassium transport system remains functional despite the extreme environmental conditions, contributing to M. infernorum's remarkable ability to thrive in hostile habitats.

What experimental approaches best capture the in vivo activity of kdpC in extremophilic conditions?

Investigating the in vivo activity of kdpC in extremophilic conditions requires specialized experimental approaches that can accommodate both the extreme environmental parameters and the complex functional context of this membrane protein:

  • Reconstitution in artificial membrane systems:

    • Liposome-based functional assays using lipid compositions that mimic M. infernorum membranes

    • Nanodiscs containing the complete Kdp complex for single-molecule studies

    • Planar lipid bilayers for electrophysiological measurements under acidic and high-temperature conditions

  • Live-cell imaging techniques:

    • Fluorescence resonance energy transfer (FRET) sensors designed to withstand acidic pH and high temperatures

    • pH-resistant fluorescent proteins fused to kdpC for localization and dynamics studies

    • Super-resolution microscopy to visualize kdpC distribution and clustering in relation to other membrane proteins

  • Genetic approaches:

    • CRISPR-Cas9 gene editing to create point mutations or domain swaps in native kdpC

    • Complementation assays using modified kdpC variants in kdpC-deficient strains

    • Inducible expression systems to study concentration-dependent effects

  • Physiological measurements:

    • Real-time measurement of potassium uptake using K+-selective electrodes in acidic high-temperature conditions

    • Membrane potential measurements using voltage-sensitive dyes compatible with extremophilic conditions

    • Growth assays under varying potassium concentrations to correlate kdpC activity with cellular fitness

These approaches should be conducted at pH 2.0-2.5 and temperatures around 60°C to accurately replicate M. infernorum's optimal growth conditions , with appropriate controls to isolate kdpC-specific effects from general physiological responses to extreme conditions.

How can insights from M. infernorum kdpC structure-function relationships inform the design of ion transporters for biotechnological applications?

The unique adaptations of M. infernorum kdpC to extreme conditions offer valuable design principles for engineering ion transporters with enhanced stability and performance in challenging environments:

  • Acid-resistant ion transport interfaces: The structural features enabling kdpC to function at pH 2.0-2.5 could inform the design of acid-resistant ion transporters for applications in:

    • Bioremediation of acidic mine drainage

    • Biofuel production from acidic hydrolysates

    • Biosensors functioning in industrial acidic environments

  • Thermostable regulatory domains: The thermostability mechanisms allowing kdpC to maintain its regulatory function at 60°C could be incorporated into designed proteins for:

    • High-temperature bioprocessing

    • Thermal biosensors

    • Enzyme systems requiring prolonged high-temperature operation

  • Modular design principles: Analysis of domain interfaces in M. infernorum kdpC could reveal modular design principles for creating chimeric transporters with:

    • Custom ion selectivity

    • Tailored regulatory properties

    • Novel sensing capabilities

  • Minimal functional systems: M. infernorum's streamlined genome (2,287,145 bp) suggests evolutionary pressure toward minimal functional systems. The kdpC component likely represents a highly optimized design with minimal redundancy, offering insights for synthetic biology approaches aimed at creating minimal ion transport systems.

The adaptations found in M. infernorum proteins, including the major upward shift in isoelectric points , provide specific molecular strategies that can be incorporated into rational protein design pipelines to enhance stability under extreme conditions.

What comparative genomic approaches are most informative for studying the evolution of kdpC in extremophiles?

Studying the evolution of kdpC in extremophiles like M. infernorum requires specialized comparative genomic approaches that can capture both broad evolutionary patterns and specific adaptations:

  • Phylogenomic analysis across environmentally diverse bacteria:

    • Construction of phylogenetic trees using kdpC sequences from acidophiles, thermophiles, neutrophiles, and mesophiles

    • Correlation of evolutionary distances with environmental parameters

    • Identification of convergent evolution patterns in unrelated extremophiles

  • Positive selection analysis:

    • Calculation of dN/dS ratios across kdpC sequences to identify positively selected sites

    • Branch-site models to detect episodic selection during adaptation to extreme environments

    • Structural mapping of selected sites to identify functional hotspots

  • Horizontal gene transfer detection:

    • Analysis of genomic contexts and GC content in kdpC and flanking regions

    • Reconciliation of gene trees with species trees to identify transfer events

    • Analysis of mobile genetic elements associated with kdp operons

  • Ancestral sequence reconstruction:

    • Rebuilding ancestral kdpC sequences at key evolutionary transitions

    • Experimental characterization of reconstructed proteins to track functional shifts

    • Computational modeling of ancestral proteins under various environmental conditions

These approaches should consider M. infernorum's unique evolutionary position as part of the PVC (Planctomycetes, Verrucomicrobia, Chlamydiae) superphylum and its extensive horizontal gene exchange history, particularly with Proteobacteria . Analysis might reveal whether the kdp system was part of the 262 genes gained during M. infernorum's evolution or represents a core system retained despite the loss of 526 genes from the last common bacterial ancestor .

What are the optimal conditions and methods for analyzing kdpC-mediated potassium transport kinetics in reconstituted systems?

Analyzing kdpC-mediated potassium transport kinetics in reconstituted systems requires carefully designed experimental conditions that reflect M. infernorum's extreme physiological environment while allowing precise measurements:

Optimal Experimental Conditions:

ParameterRecommended RangeRationale
pH2.0-3.0Matches M. infernorum's optimal growth pH (2.0-2.5)
Temperature55-65°CCenters around optimal growth temperature (60°C)
K+ concentration range1 μM - 10 mMCovers high-affinity transport regime
Buffer systemCitrate-phosphateMaintains stability at low pH
Ionic strength control50-150 mM NaCl equivalentPhysiologically relevant while minimizing interference

Recommended Methodological Approaches:

  • Proteoliposome-based transport assays:

    • Preparation of proteoliposomes containing purified recombinant Kdp complex

    • Use of K+-sensitive fluorescent dyes (e.g., PBFI adapted for acidic conditions)

    • Stopped-flow measurements to capture rapid kinetics

    • Establishment of pH and electrical gradients to assess driving forces

  • Solid-supported membrane electrophysiology:

    • Adsorption of proteoliposomes onto sensor chips

    • Measurement of transient currents following K+ concentration jumps

    • Analysis under varying pH and temperature conditions

    • Determination of rate-limiting steps through systematic parameter variation

  • Single-molecule approaches:

    • Fluorescence correlation spectroscopy to monitor conformational changes

    • Magnetic tweezers to assess mechanical properties during transport cycle

    • High-speed atomic force microscopy to visualize structural dynamics

  • Computational integration:

    • Development of kinetic models incorporating experimental data

    • Molecular dynamics simulations under extremophilic conditions

    • Machine learning approaches to identify patterns in complex kinetic datasets

These methods should incorporate appropriate controls, including:

  • Reconstituted systems without kdpC to isolate its specific contribution

  • Variants with site-directed mutations to probe key functional residues

  • Comparisons with mesophilic Kdp systems to identify extremophile-specific kinetic properties

How might the study of M. infernorum kdpC inform our understanding of ion homeostasis in early evolution and astrobiology?

The study of M. infernorum kdpC provides unique insights into ion homeostasis mechanisms that may have operated in early evolutionary history and potentially in extraterrestrial environments:

  • Early Earth condition adaptations: M. infernorum's ability to thrive at pH 2.0-2.5 and 60°C represents conditions potentially prevalent on early Earth. The kdpC-mediated potassium homeostasis system may exemplify mechanisms that enabled cellular life to colonize acidic thermal environments during Earth's early history, when:

    • Volcanic activity was more widespread

    • Atmospheric composition created more acidic conditions

    • Thermal gradients were steeper near hydrothermal systems

  • Extremophile convergent evolution: Comparative analysis of kdpC from M. infernorum with potassium transport systems from other extremophiles could reveal:

    • Universal constraints in ion transport under extreme conditions

    • Distinct evolutionary solutions to similar environmental challenges

    • Minimum requirements for functional ion homeostasis

  • Astrobiological implications: M. infernorum's adaptations inform the search for life in extraterrestrial environments with:

    • Acidic conditions (like Mars surface chemistry)

    • Temperature extremes (like Europa's subsurface ocean thermal vents)

    • Limited nutrient availability (reflected in M. infernorum's streamlined genome)

  • Minimal functional systems: The dual ATPase systems in M. infernorum, with potentially specialized roles in energy generation versus pH homeostasis , alongside the kdp system for potassium homeostasis, may represent a minimal functional set of ion transport systems required for life under extreme conditions. This provides a framework for understanding the essential ion homeostasis requirements for primitive cellular systems.

This research connects to broader questions about the limits of life, the universality of certain cellular functions, and the adaptability of biological systems to extreme environments. The unique evolutionary position of M. infernorum, with its extensive horizontal gene transfer history yet distinctive adaptations to acidophilic conditions, makes its ion transport systems particularly valuable for understanding fundamental principles of cellular homeostasis.

What are common pitfalls in heterologous expression of M. infernorum kdpC and how can they be avoided?

Heterologous expression of M. infernorum kdpC presents several challenges due to its extremophilic origin and membrane-associated nature. Here are common pitfalls and strategies to address them:

Common Pitfalls and Solutions:

  • Protein misfolding and aggregation:

    • Pitfall: Standard expression at 37°C may cause misfolding of thermophilic proteins

    • Solution: Express at elevated temperatures (42-45°C) or use cold-shock promoters with extended low-temperature expression

    • Alternative approach: Co-express with chaperones specific for thermophilic proteins

  • Toxicity to host cells:

    • Pitfall: Membrane proteins can disrupt host membrane integrity

    • Solution: Use tightly regulated expression systems (e.g., pET with T7 lysozyme co-expression)

    • Alternative approach: Direct expression to inclusion bodies with subsequent refolding

  • Codon usage bias:

    • Pitfall: M. infernorum's G+C content (45.5%) and codon preferences differ from common expression hosts

    • Solution: Use codon-optimized synthetic genes or express in Rosetta strains with rare tRNA supplementation

  • Post-translational modifications:

    • Pitfall: Required modifications may be absent in heterologous hosts

    • Solution: Check sequence for potential modification sites and consider expression in eukaryotic systems if necessary

  • Improper membrane insertion:

    • Pitfall: Membrane targeting may fail in heterologous systems

    • Solution: Fusion with well-characterized membrane targeting sequences

    • Alternative approach: Cell-free expression systems with supplied membranes or nanodiscs

Validation Strategies:

Validation MethodWhat It MeasuresTroubleshooting Value
Western blot with anti-His tagExpression levelConfirms protein production
Membrane fractionationMembrane localizationVerifies proper targeting
Circular dichroism at 60°C, pH 3.0Secondary structureConfirms proper folding under native conditions
Size exclusion chromatographyAggregation stateIdentifies problematic aggregation
KdpB binding assayFunctional conformationVerifies biological activity

The expression strategy should consider M. infernorum's adaptations for extremely acidic conditions, including the upward shift in isoelectric points of its proteins , which may affect solubility and stability in standard expression systems.

How should researchers interpret contradictory experimental results when studying recombinant kdpC function across different pH and temperature conditions?

When confronted with contradictory experimental results in studies of recombinant kdpC function across pH and temperature conditions, researchers should apply a systematic analytical framework:

  • Contextual assessment of experimental conditions:

    • Consider pH-temperature interactions: Proteins often show coupled responses to pH and temperature; apparent contradictions may reflect complex phase boundaries in the protein's stability landscape

    • Analyze buffer composition effects: Different buffers at the same nominal pH may create different ionic microenvironments affecting kdpC function

    • Evaluate experimental timescales: Kinetic trapping in metastable states may lead to time-dependent results that appear contradictory

  • Protein state analysis:

    • Characterize oligomeric state: Contradictory results may reflect different oligomeric states of kdpC under different conditions

    • Assess post-translational modifications: Verify whether modifications are consistent across experiments

    • Examine protein-lipid interactions: Variations in membrane composition can dramatically alter membrane protein function

  • Methodological reconciliation approaches:

    • Perform method-bridging experiments: Design experiments that connect different methodologies to identify method-specific artifacts

    • Control for equipment-specific effects: Cross-validate using different instruments for the same measurements

    • Standardize protein preparations: Use identical purification protocols and quality control metrics

  • Biological interpretation framework:

    • Consider native ecological context: M. infernorum experiences temperature and pH fluctuations in geothermal environments; apparent contradictions may reflect biological adaptability

    • Evaluate evolutionary constraints: Compare with homologous proteins from related organisms to identify conserved behaviors versus experimental artifacts

    • Map to structural domains: Localize contradictory behaviors to specific protein domains to identify functional specializations

When interpreting results, researchers should remember that M. infernorum has evolved for extreme conditions (pH 2.0-2.5, 60°C) and its proteins show adaptations like shifted isoelectric points . Standard assumptions about protein behavior developed from mesophilic systems may not apply, and apparent contradictions might actually reveal novel biological mechanisms adapted to extreme conditions.

What quality control metrics should be established to ensure the structural and functional integrity of purified recombinant kdpC?

Ensuring the structural and functional integrity of purified recombinant kdpC from M. infernorum requires comprehensive quality control metrics tailored to this extremophilic membrane protein:

Structural Integrity Metrics:

Quality Control MetricAcceptance CriteriaRationale
SDS-PAGE purity>95% homogeneityEnsures minimal contaminants
Mass spectrometryMass within 0.1% of theoreticalConfirms primary sequence integrity
Circular dichroism at 60°C, pH 3.0Characteristic secondary structure profileVerifies native-like folding under native conditions
Thermal shift assayTm ≥ 70°C at pH 3.0Confirms expected thermostability
Dynamic light scatteringMonodisperse populationRules out problematic aggregation
Limited proteolysisDefined fragmentation patternIndicates proper folding

Functional Integrity Metrics:

Quality Control MetricAcceptance CriteriaRationale
KdpB binding assayKd within 2-fold of native complexVerifies interaction capacity
ATPase stimulationMeasurable enhancement of KdpB activityConfirms functional coupling
Reconstitution efficiency>70% correctly oriented incorporationEnsures proper membrane insertion
K+ transport in proteoliposomesSpecific activity >50% of predictedValidates transport function
pH-dependent activity profileOptimal activity at pH 2.0-3.0Confirms acidophilic adaptation
Temperature-dependent activityOptimal activity at 55-65°CVerifies thermophilic properties

Batch-to-Batch Consistency Requirements:

  • Reference standard comparison: Each batch should be compared to a well-characterized reference preparation using:

    • Overlay of size exclusion chromatography profiles

    • Comparative circular dichroism spectra

    • Side-by-side functional assays

  • Storage stability monitoring:

    • Accelerated stability testing at elevated temperatures

    • Regular retesting of frozen aliquots

    • Monitoring of critical quality attributes over time

  • Lot release specifications:

    • Documentation of expression conditions and cell density at harvest

    • Complete purification record with yields at each step

    • Final concentration, purity, and specific activity measurements

These metrics should be adapted to M. infernorum's extremophilic nature, recognizing that optimal structural and functional characteristics may differ significantly from those of mesophilic proteins. Quality control should be performed both under standard conditions and under conditions mimicking M. infernorum's native environment (pH 2.0-2.5, 60°C) to ensure the protein maintains its specialized adaptations.

How do variations in experimental conditions affect the interpretation of structural studies on M. infernorum kdpC?

Structural studies on M. infernorum kdpC require careful consideration of how experimental conditions influence both the protein's conformation and the interpretation of structural data:

  • pH-dependent structural changes:

    • Effect: M. infernorum proteins have shifted isoelectric points as adaptations to acidic conditions , suggesting pH-dependent conformational states

    • Interpretation challenge: Structures determined at standard pH (6-8) may not represent native functional states

    • Solution: Perform structural analyses across pH gradient (pH 2-7) to capture the full conformational landscape

    • Validation approach: Correlate structural changes with functional measurements at corresponding pH values

  • Temperature-induced conformational shifts:

    • Effect: As a thermophilic protein adapted to 60°C environments , kdpC likely has temperature-dependent structural features

    • Interpretation challenge: Room-temperature or cryo-structures may capture inactive conformations

    • Solution: Employ techniques allowing structural characterization at elevated temperatures (NMR, HDX-MS at varied temperatures)

    • Validation approach: Compare results from multiple structural methods with different temperature requirements

  • Membrane environment variations:

    • Effect: Lipid composition significantly influences membrane protein structure

    • Interpretation challenge: Detergent-solubilized structures may not reflect native membrane-embedded conformations

    • Solution: Compare structures in different membrane mimetics (detergents, nanodiscs, liposomes)

    • Validation approach: Validate with functional assays in corresponding membrane environments

  • Crystal packing artifacts:

    • Effect: Crystal contacts can distort membrane protein structures

    • Interpretation challenge: Distinguishing biological interfaces from crystal contacts

    • Solution: Obtain multiple crystal forms or complement with solution methods (SAXS, cryo-EM)

    • Validation approach: Cross-validate key structural features across multiple structural determination methods

Structure Determination Method Comparison:

MethodAdvantages for kdpCLimitationsOptimal Conditions
X-ray crystallographyHigh resolution atomic detailsRequires crystallization; potential artifactsAcidic crystallization conditions (pH 3-4)
Cryo-EMNative-like conditions; no crystallization neededResolution limitations for small membrane proteinsVitrification from acidic buffers
Solution NMRDynamic information; pH titration possibleSize limitations; requires detergent optimizationVariable temperature experiments (25-60°C)
HDX-MSConformational dynamics across conditionsLower resolution structural informationCan be performed at pH 2.5, 60°C
SAXS/SANSSolution structure in near-native conditionsLow resolution envelope onlyCompatible with acidic conditions

When interpreting structural data, researchers should consider M. infernorum's evolutionary context as part of the PVC superphylum and its adaptation to extreme environments. Structural features that appear unusual by comparison to mesophilic homologs may represent specific adaptations rather than artifacts or errors in structure determination.

How might cryo-EM and advanced biophysical techniques enhance our understanding of the M. infernorum Kdp complex structure-function relationships?

Cryo-electron microscopy (cryo-EM) and advanced biophysical techniques offer promising avenues to deepen our understanding of M. infernorum Kdp complex structure-function relationships, particularly in addressing challenges unique to this extremophilic system:

  • High-resolution structure determination under near-native conditions:

    • Cryo-EM advantage: Captures the Kdp complex in a near-native membrane environment without crystallization

    • Research opportunity: Resolve the complete Kdp complex including kdpC in various functional states

    • Technical innovation needed: Development of acidic buffer systems compatible with cryo-EM grid preparation

    • Expected insight: Identification of unique structural features enabling function at pH 2.0-2.5 and 60°C

  • Conformational dynamics analysis:

    • Technique combination: Time-resolved cryo-EM with hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Research opportunity: Map the conformational landscape of the Kdp complex during the transport cycle

    • Technical innovation needed: Methods for initiating synchronized transport cycles before vitrification

    • Expected insight: Mechanism of potassium transport coupled to ATP hydrolysis under extreme conditions

  • In situ structural biology:

    • Emerging techniques: Cryo-electron tomography and subtomogram averaging

    • Research opportunity: Visualize the Kdp complex in its native membrane context within M. infernorum cells

    • Technical innovation needed: Methods for thinning extremophile cells for tomography

    • Expected insight: Native organization, clustering, and interaction with other membrane systems

  • Single-molecule functional imaging:

    • Biophysical approach: High-speed atomic force microscopy combined with patch-clamp fluorometry

    • Research opportunity: Correlate structural changes with transport events in real-time

    • Technical innovation needed: Development of stable lipid bilayers mimicking M. infernorum membranes

    • Expected insight: Direct observation of how extreme conditions modify transport mechanics

These advanced techniques would help resolve key questions about how M. infernorum's Kdp complex achieves potassium transport under conditions that would denature most proteins, potentially revealing novel mechanisms of ion transport and protein stabilization. The insights gained would complement our understanding of M. infernorum's specialized adaptations, including the upward shift in protein isoelectric points and its unique dual ATPase systems with potentially specialized roles .

What gene editing approaches could best advance functional studies of kdpC in M. infernorum?

  • CRISPR-Cas9 systems adapted for acidophilic conditions:

    • Adaptation requirement: Development of Cas9 variants stable at low pH and high temperature

    • Design consideration: Optimization of guide RNA stability under acidic conditions

    • Delivery method: Conjugation systems using acid-resistant donor strains

    • Application: Precise kdpC mutations to identify critical residues for function

  • Recombineering approaches using phage recombinases:

    • Key components: Thermostable recombinases expressed under acid-inducible promoters

    • Target modification: Allelic replacement of kdpC with tagged or mutant variants

    • Selection strategy: Dual selection using acid-stable antibiotics or counter-selectable markers

    • Application: Introduction of reporter fusions to monitor kdpC expression and localization

  • Transposon mutagenesis systems:

    • System design: Acid-stable transposons with regulated transposition

    • Screening approach: Conditional lethality screens under potassium limitation

    • Analysis method: Deep sequencing to identify insertion sites affecting kdpC function

    • Application: Identification of genetic interactions with the kdp system

  • Inducible expression systems:

    • Promoter engineering: Development of tightly regulated acid-inducible promoters

    • Vector development: Acid-stable plasmids with thermoresistant replication systems

    • Expression control: Titratable induction systems functional at pH 2.0-2.5

    • Application: Complementation studies with kdpC variants to assess function

Implementation considerations specific to M. infernorum:

ChallengePotential SolutionRationale
Low transformation efficiencyElectroporation at elevated temperaturesMay increase membrane fluidity
Nuclease degradation of introduced DNAMethylation patterns mimicking native M. infernorumProtection from restriction enzymes
Plasmid instability at low pHEngineering of pH-resistant origins of replicationBased on analysis of native M. infernorum mobile elements
Selection marker limitationsDevelopment of markers based on acid resistance genesLeverages natural acid adaptation mechanisms

These genetic approaches should consider M. infernorum's streamlined genome (2,287,145 bp) and potential integration sites that avoid disruption of essential functions. The presence of CRISPR-Cas systems in related strains within the "Ca. Methylacidiphilum" genus suggests potential for adapting native CRISPR systems for genome editing in M. infernorum.

What computational approaches could help predict the impact of point mutations on kdpC stability and function under extreme conditions?

Advanced computational approaches offer powerful tools for predicting how point mutations affect kdpC stability and function in the extreme conditions where M. infernorum thrives:

  • Molecular dynamics simulations under extremophilic conditions:

    • Simulation parameters: Modified force fields incorporating low pH (2.0-2.5) and high temperature (60°C) effects

    • Analysis focus: Conformational stability, salt bridge networks, and water interaction patterns

    • Technical innovation: Extended timescale simulations (microseconds) to capture slow conformational changes

    • Predictive output: Stability changes (ΔΔG) upon mutation under varying pH and temperature conditions

  • Quantum mechanics/molecular mechanics (QM/MM) approaches:

    • Application: Modeling protonation-dependent interactions in the kdpC active site

    • Analysis focus: Electronic structure changes affecting ion coordination at low pH

    • Technical requirement: QM region encompassing key residues interacting with potassium ions

    • Predictive output: Changes in ion binding energetics upon mutation under acidic conditions

  • Machine learning models trained on extremophile proteins:

    • Training data: Curated dataset of mutations in acidophilic and thermophilic proteins

    • Feature engineering: Incorporation of pH-dependent electrostatic features

    • Model architecture: Deep neural networks with attention mechanisms for spatial context

    • Predictive output: Multi-parameter prediction of stability, activity, and pH-dependence changes

  • Coevolutionary analysis and statistical coupling:

    • Dataset: Multiple sequence alignment of kdpC homologs across pH and temperature gradients

    • Analysis approach: Identification of evolutionarily coupled residues using direct coupling analysis

    • Interpretation framework: Mapping coupled positions to structural interfaces

    • Predictive output: Effect of mutations on allosteric networks and protein-protein interactions

Integrated computational workflow:

These computational approaches should account for M. infernorum's specific adaptations, including the upward shift in isoelectric points of its proteins . Validation of computational predictions would require experimental testing under conditions matching M. infernorum's natural environment (pH 2.0-2.5, 60°C) , creating an iterative workflow between computation and experiment to develop increasingly accurate prediction tools for extremophilic proteins.

How might research on M. infernorum kdpC contribute to the design of pH-resistant biotechnological applications?

Research on M. infernorum kdpC offers unique insights that could advance the development of pH-resistant biotechnological applications across multiple sectors:

  • Acid-resistant biosensors and bioelectronics:

    • Design principle: Incorporation of kdpC's acid-stable structural motifs into sensing elements

    • Potential application: Continuous monitoring in acidic industrial processes

    • Technical advantage: Sensors maintaining function below pH 3.0 without protective encapsulation

    • Industry impact: Extended sensor lifetime in harsh environments like mining leachates or fermenter monitoring

  • Biocatalysts for low-pH industrial processes:

    • Design approach: Grafting of acid-stability elements from kdpC onto industrial enzymes

    • Potential application: Direct enzymatic conversion of acidic biomass hydrolysates

    • Technical advantage: Elimination of neutralization steps in bioprocessing

    • Economic impact: Reduced costs and waste in biofuel and biochemical production

  • Acid-resistant membrane protein expression systems:

    • Design principle: Development of expression vectors incorporating kdpC folding elements

    • Potential application: Production of difficult membrane proteins in acidic compartments

    • Technical advantage: Novel expression environments avoiding traditional bottlenecks

    • Research impact: Access to previously intractable membrane protein targets

  • Biomedical delivery systems for gastric environments:

    • Design approach: kdpC-inspired protein stabilization for oral biologics delivery

    • Potential application: Protein therapeutics surviving gastric transit

    • Technical advantage: Natural evolution-tested acid resistance mechanisms

    • Healthcare impact: Expanded options for non-injectable protein therapeutics

Key transferable design principles from M. infernorum kdpC:

FeatureMolecular BasisBiotechnological Application
Shifted isoelectric points Increased surface positive chargeStabilization of proteins in acidic environments
Thermostable interfacesEnhanced hydrophobic packing and salt bridgesHeat-resistant industrial enzymes
Acid-resistant cofactor bindingProtonation-resistant coordination geometryCatalysts maintaining activity at low pH
pH-dependent conformational switchesStrategic placement of titratable residuesEngineered pH-responsive actuators and switches

The research on M. infernorum kdpC contributes to a broader understanding of molecular adaptations to extreme conditions. The organism's evolutionary solutions to the dual challenges of high temperature (60°C) and extreme acidity (pH 2.0-2.5) provide valuable templates for rational design of biotechnological tools with enhanced stability in harsh industrial conditions.

By studying how nature has solved the problem of protein function in extreme environments through systems like the kdpC in M. infernorum, we gain design principles that can be applied across biotechnology to create more robust and versatile biological tools.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.