Recombinant Methylamine utilization protein mauE (mauE)

Shipped with Ice Packs
In Stock

Description

Biological Role in Methylamine Metabolism

MauE is part of the mau gene cluster (mauFBEDACJG) required for MADH biosynthesis and function:

  • Essential for MADH Stability: mauE mutants in Paracoccus denitrificans and Methylobacterium extorquens fail to grow on methylamine due to degradation of the MADH β-subunit .

  • Membrane Localization: MauE’s transmembrane helices suggest involvement in transporting or stabilizing MADH subunits during periplasmic assembly .

  • Disulfide Bond Formation: Works alongside MauD to process structural disulfide bonds in the MADH β-subunit, critical for TTQ (tryptophan tryptophylquinone) cofactor biosynthesis .

Success in Rhodobacter sphaeroides

  • Gene Cluster Requirement: Co-expression of mauFBEDACJG in R. sphaeroides yielded functional MADH indistinguishable from native enzyme in kinetics, spectroscopy, and localization .

  • Constitutive Expression: Unlike native mau promoters (methylamine-inducible), recombinant expression via the coxII promoter was carbon source-independent .

Challenges in Escherichia coli

  • Failed Expression: Despite promoter activity, E. coli produced no detectable MADH, likely due to improper folding/processing of MauE or other accessory proteins .

Comparative Analysis of MauE Across Species

OrganismMauE FeaturesRole in MADH Biosynthesis
Methylobacterium extorquens186 residues, 5 transmembrane helices, periplasmic orientation Stabilizes β-subunit, ensures disulfide bond formation
Paracoccus denitrificans190 residues, membrane-associated, conserved Cys-Pro-Xaa-Cys motif Critical for β-subunit maturation and TTQ synthesis
Methylophilus methylotrophusHigh sequence similarity (~50%) to M. extorquens MauE Required for MADH assembly in methylamine metabolism

Research Implications

  • Biotechnological Applications: Recombinant MauE enables studies on MADH biosynthesis mechanisms, particularly TTQ cofactor assembly .

  • Genetic Engineering Insights: Failures in E. coli expression highlight the complexity of redox and membrane-associated processes requiring specialized host systems like R. sphaeroides .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary based on the purchase method or location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize the development of the specified tag.
Synonyms
mauE; Methylamine utilization protein MauE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Paracoccus denitrificans
Target Names
mauE
Target Protein Sequence
MADFLIQPMVLWALRIFLALLFVAAALSKLRHVEEFYGVVRNFRVLPDLASRVVALVLPV VEAAVAVGLVVTPLAVPAAVAAAALLLVFAAALAINVLRGRTQIDCGCFRNGLKQPVSWL LVLRNLVLTALALAIATGLPAAVPASLTEGATGLLAGATAMLIYLSASLLGGLSAAQTAN KTAKGR
Uniprot No.

Target Background

Function
This protein may be specifically involved in the processing, transport, and/or maturation of the MADH beta-subunit.
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the methylamine utilization protein MauE and what is its function?

Methylamine utilization protein MauE is an integral component of the methylamine utilization (mau) gene cluster found in bacteria capable of using methylamine as a carbon source, such as Paracoccus denitrificans. Based on its deduced sequence, MauE appears to be a membrane protein that plays a crucial role in the biosynthesis and assembly of methylamine dehydrogenase (MADH) .

Functionally, MauE is involved in the translocation of the MADH small subunit (MauA) across the bacterial membrane during the protein's biogenesis. Experimental evidence from mutational studies has shown that P. denitrificans cells with mutations in the mauE gene lack the MADH small subunit and exhibit reduced levels of the large subunit (MauB) . This suggests that MauE's function is essential for the proper assembly and stability of the complete MADH enzyme complex.

How is MauE related to methylamine dehydrogenase (MADH) assembly?

MauE plays a critical role in the assembly pathway of functional MADH. The biosynthesis of MADH is a complex process that requires several accessory proteins encoded by the mau gene cluster in addition to the structural proteins MauA and MauB. Studies have shown that MauE is specifically involved in the translocation of the MauA subunit across the membrane to the periplasm .

When the mauE gene is mutated or absent, as demonstrated in P. denitrificans mutants, cells become devoid of the MauA subunit and show reduced levels of MauB . This indicates that MauE is essential for the proper localization and stability of MauA, which subsequently affects the assembly of the complete MADH enzyme. Without functional MauE, the MADH subunits likely undergo rapid degradation due to improper assembly or modification .

Which bacterial species contain the mauE gene, and how conserved is it?

The mauE gene has been well-characterized in Paracoccus denitrificans, where it is part of the mau gene cluster that enables methylamine utilization. The protein appears to be relatively conserved among bacteria that can metabolize single-carbon compounds, particularly methylamine. The functional expression studies indicate a degree of specificity in the MauE protein's interactions, as evidenced by the inability of E. coli to properly process the MADH subunits despite expressing other mau genes .

Research has shown that while Rhodobacter sphaeroides does not naturally utilize methylamine as a carbon source, it can successfully express a functional recombinant MADH when provided with the complete set of necessary mau genes, including mauE . This suggests that R. sphaeroides possesses cellular machinery compatible with MauE function, unlike E. coli which appears to lack certain endogenous components required for proper MauE activity.

What expression systems have been successfully used for recombinant MauE production?

Successful expression of functional MauE as part of the complete methylamine utilization system has been demonstrated in Rhodobacter sphaeroides. In a key study, researchers placed the genes mauFBEDACJG from P. denitrificans under the control of the coxII promoter from R. sphaeroides in a broad-host-range vector . This construct was then introduced into R. sphaeroides, resulting in the successful expression of functional MADH with all its components, including properly functioning MauE.

The expression of MauE in E. coli has been attempted but was unsuccessful in producing functional MADH. While amicyanin (MauC) was expressed in E. coli containing the mau gene cluster, neither MauA nor MauB subunits were detected . This suggests that E. coli lacks certain factors required for the proper expression or functioning of MauE or other accessory proteins necessary for MADH assembly.

Why is E. coli not suitable for functional expression of MauE and the complete MADH system?

E. coli has been shown to be unsuitable for the functional expression of MauE and the complete MADH system due to several possible reasons:

  • MauE is a membrane protein that may require specific membrane compositions or characteristics not present in E. coli .

  • The proper functioning of MauE might depend on other bacterial components that are present in P. denitrificans and R. sphaeroides but absent in E. coli .

  • E. coli may lack specific cofactors required for MauE activity or for the correct post-translational processing of MauE .

  • The translocation machinery in E. coli might be incompatible with MauE or MauA, preventing proper membrane insertion or periplasmic localization .

When attempts were made to express the complete mau gene cluster in E. coli, only amicyanin (MauC) was successfully expressed and detected, while the MADH subunits were absent . This suggests that MauE and possibly other accessory proteins were not functioning properly in E. coli, leading to improper assembly and rapid degradation of the MADH subunits.

How can I optimize the heterologous expression of MauE in R. sphaeroides?

For optimal heterologous expression of MauE as part of the functional MADH system in R. sphaeroides, consider the following approaches based on successful experimental strategies:

  • Promoter selection: Use the coxII promoter from R. sphaeroides, which has been demonstrated to drive strong constitutive expression of the mau genes in aerobic conditions, independent of carbon source .

  • Gene organization: Ensure that the complete set of necessary genes (mauFBEDACJG) is included in the expression construct, maintaining their natural organization to preserve any important intergenic regions .

  • Vector selection: Utilize a broad-host-range vector compatible with R. sphaeroides for stable maintenance of the expression construct .

  • Growth conditions: Grow R. sphaeroides under aerobic conditions to ensure optimal activity of the coxII promoter. The use of succinate as a carbon source has been shown to support high-level expression .

  • Protein localization: Verify that expressed MauE and MADH are correctly localized in the membrane and periplasm, respectively, as improper localization may indicate problems with expression or assembly .

When optimized, this approach can yield approximately 35 mg of MADH per 100 g (wet weight) of R. sphaeroides cells, which is about 20% of the level produced by wild-type P. denitrificans grown on methylamine .

What methods are effective for detecting and quantifying MauE expression?

Due to the membrane-associated nature of MauE, several specialized techniques are recommended for its detection and quantification:

  • Western blot analysis: Using specific antibodies against MauE is particularly effective for detecting the protein in membrane fractions. This technique was successfully used to analyze MauE expression in P. denitrificans mutant strains .

  • Indirect quantification: Since MauE is essential for MADH assembly, MADH activity can serve as an indirect measure of functional MauE expression. MADH activity can be assayed spectrophotometrically using artificial electron acceptors .

  • Periplasmic extraction: To assess the effectiveness of MauE in translocating MauA to the periplasm, periplasmic extracts can be prepared and analyzed for the presence of MADH subunits .

  • Molar ratio analysis: Compare the molar quantities of MADH and amicyanin (MauC) in recombinant systems. In successfully expressing systems, these proteins are typically present in approximately equimolar amounts .

Detection of functional MauE often relies on its effect on other components of the methylamine utilization system rather than direct measurement, as direct visualization and quantification of membrane proteins present additional challenges.

How can I assess whether recombinant MauE is correctly folded and functional?

Assessing the correct folding and functionality of recombinant MauE requires indirect methods, as its function is predominantly observed through its effects on MADH assembly:

  • MADH subunit detection: The presence of stable MauA (small subunit) in the periplasm strongly indicates functional MauE, as MauE is required for MauA translocation and stability. Absence of MauA despite the presence of other mau genes suggests non-functional MauE .

  • Enzyme activity assays: Functional MADH enzyme activity is a key indicator of proper MauE function. MADH activity can be measured by its ability to oxidize methylamine with various electron acceptors .

  • Spectroscopic analysis: Correctly assembled MADH containing the TTQ cofactor has distinctive spectroscopic properties. Compare the spectroscopic, kinetic, and redox properties of the recombinant MADH with those of the native enzyme from P. denitrificans .

  • Subcellular fractionation: Analyze the membrane fraction for the presence of MauE and the periplasmic fraction for MADH. Proper partitioning of these proteins to their respective compartments indicates functional expression .

In the successful heterologous expression system using R. sphaeroides, the recombinant MADH was localized exclusively in the periplasm, and its properties were indistinguishable from those of the enzyme isolated from P. denitrificans, indicating proper function of all accessory proteins including MauE .

What is the relationship between MauE and the TTQ prosthetic group biosynthesis?

The tryptophan tryptophylquinone (TTQ) prosthetic group is essential for MADH function, and its biosynthesis involves post-translational modifications of tryptophan residues in the MauA subunit. While MauE itself may not directly catalyze TTQ formation, it plays an indirect but critical role in this process by ensuring proper translocation and positioning of the MauA subunit .

Research has shown that the genes mauFBEDACJG are sufficient for TTQ biosynthesis in R. sphaeroides, which naturally cannot synthesize TTQ . Among these, MauG has been identified as potentially encoding a heme-bearing peroxidase that may be directly involved in the oxygenation reactions required for TTQ formation . MauE's role appears to be in ensuring that MauA is properly positioned in the periplasm where it can undergo the modifications necessary for TTQ formation.

The interdependence of these processes is highlighted by the observation that mutations in mauE lead to absence of the MauA subunit, consequently preventing TTQ formation . This suggests a sequential assembly process where MauE-mediated translocation precedes and is necessary for TTQ biosynthesis.

How does MauE interact with other components of the methylamine utilization system?

The exact molecular interactions between MauE and other components of the methylamine utilization system remain incompletely characterized, but functional studies provide important insights:

  • Interaction with MauA: MauE appears to specifically interact with the MauA subunit, facilitating its translocation across the membrane to the periplasm. This interaction may involve recognition of specific sequences or structural features in MauA .

  • Potential interactions with MauD: MauD is believed to be involved in disulfide bond processing, particularly in the formation of the six disulfide bonds present in the MauA subunit. MauE may work cooperatively with MauD to ensure proper folding of MauA following translocation .

  • System-wide coordination: The observation that proportional amounts of MADH and amicyanin are produced in recombinant expression systems suggests coordinated expression and assembly of the entire methylamine utilization system, implying functional interactions between its components .

  • Host-specific interactions: The failure of E. coli to express functional MADH despite expressing amicyanin suggests that MauE requires specific interactions with host components that are present in P. denitrificans and R. sphaeroides but absent in E. coli .

Understanding these interactions remains an active area of research and may benefit from techniques such as cross-linking studies, co-immunoprecipitation, and site-directed mutagenesis to identify critical interaction domains.

What experimental approaches can help resolve discrepancies in MauE functional studies?

When facing discrepancies in MauE functional studies, consider these methodological approaches:

  • Comparative expression systems: Utilize multiple host organisms (e.g., P. denitrificans, R. sphaeroides, and E. coli) to express MauE under identical conditions, allowing direct comparison of its functionality in different cellular environments .

  • Domain swapping experiments: Create chimeric proteins combining domains from MauE proteins of different species to identify functionally critical regions and species-specific differences .

  • Controlled mutagenesis: Perform systematic site-directed mutagenesis of mauE to identify residues critical for function. Compare the effects of identical mutations across different expression systems .

  • Complementation studies: Use the R. sphaeroides expression system with the coxII promoter to express various mutated versions of mauE and assess their ability to restore MADH assembly and function .

  • Protein localization studies: Employ techniques like fractionation, immunogold electron microscopy, or fluorescent protein fusions to track the localization of MauE and MADH subunits in different expression systems and mutant strains .

By systematically applying these approaches and carefully controlling experimental variables, researchers can resolve discrepancies and develop a more unified understanding of MauE function.

Why might I observe low expression levels of recombinant MauE and MADH?

Low expression levels of recombinant MauE and MADH can result from several factors:

  • Promoter strength: The native mau promoter is strongly induced by methylamine but repressed by other carbon sources. When using alternative promoters like coxII, expression levels may be lower (approximately 20% of native levels) due to differences in promoter strength .

  • Promoter compatibility: The coxII promoter from R. sphaeroides functions well in its native host but shows significantly reduced activity (approximately 3% comparatively) when used in P. denitrificans, highlighting the importance of promoter-host compatibility .

  • Growth conditions: The coxII promoter is regulated by oxygen concentration and functions only under aerobic conditions. Ensure appropriate aeration of cultures .

  • Post-translational processing issues: Incomplete or incorrect processing of MauE or MADH subunits can lead to protein degradation. This is particularly relevant when expressing in heterologous hosts that may lack necessary processing factors .

  • Protein stability: Improperly assembled MADH subunits are subject to rapid degradation. Even if initial expression is adequate, steady-state levels may appear low due to degradation of unstable proteins .

To address these issues, consider optimizing growth conditions, testing alternative promoters, or supplementing growth media with factors that might enhance stability or folding of the recombinant proteins.

How can I distinguish between problems with MauE expression versus MauE dysfunction?

Distinguishing between inadequate MauE expression and expressed but non-functional MauE requires a systematic analytical approach:

  • Direct detection of MauE: Use techniques such as Western blotting with anti-MauE antibodies to directly detect the presence of MauE in membrane fractions. This will establish whether the protein is being expressed .

  • Comparative analysis with amicyanin: The expression of amicyanin (MauC) can serve as a valuable internal control. If amicyanin is expressed but MADH is not detected, this suggests that the issue lies with MauE functionality rather than general expression problems. This pattern was observed in E. coli expressing the mau gene cluster .

  • Subcellular localization analysis: Determine whether MauE is correctly localized to the membrane. Improper localization may indicate folding or targeting issues rather than expression problems .

  • Complementation tests: Introduce wild-type mauE gene into the system showing problems. If this restores MADH assembly and activity, it confirms that the issue was with MauE specifically .

  • Analysis of MauA localization: Since MauE's primary function appears to be in MauA translocation, analyzing the subcellular location of MauA can indicate whether MauE is functional. Absence of MauA in the periplasm despite its expression suggests MauE dysfunction .

This systematic approach can help pinpoint whether the issue lies with expression, localization, or functionality of MauE, guiding further troubleshooting efforts.

What factors should be considered when adapting MauE expression systems to new host organisms?

When adapting MauE expression systems to new host organisms, consider these critical factors:

  • Membrane compatibility: MauE is a membrane protein, so the composition and structure of the host organism's membrane can significantly impact its proper insertion and function .

  • Promoter selection: Choose promoters that are well-characterized in the target host. As demonstrated with the coxII promoter, promoter efficiency can vary dramatically between organisms (e.g., strong activity in R. sphaeroides but weak in P. denitrificans) .

  • Accessory factors: Consider whether the host organism possesses necessary accessory factors for MauE function. The inability of E. coli to express functional MADH despite expressing other mau genes suggests it lacks factors present in P. denitrificans and R. sphaeroides .

  • Protein processing machinery: Ensure the host has appropriate machinery for protein translocation, disulfide bond formation, and other post-translational modifications essential for MauE and MADH assembly .

  • Metabolic context: Consider the metabolic capabilities of the host organism. For example, R. sphaeroides containing the mau genes still couldn't grow on methylamine as a sole carbon source, likely due to limitations in downstream metabolic pathways .

  • Growth conditions: Optimize growth conditions based on both the requirements of the expression system (e.g., aerobic conditions for the coxII promoter) and the natural habitat of the host organism .

When transferring the mau genes to a new host, it's advisable to include all the genes from mauFBEDACJG to ensure all necessary components are present for proper MauE function and MADH assembly .

What are the most promising applications of recombinant MauE research?

Research on recombinant MauE has several promising applications:

  • Model system for membrane protein biogenesis: MauE provides an excellent model for studying membrane protein topology, folding, and function, particularly in the context of complex multi-protein assemblies .

  • Tool for studying protein translocation mechanisms: The specific role of MauE in translocation of the MauA subunit makes it valuable for investigating protein export pathways in bacteria .

  • Platform for engineering methylamine metabolism: Understanding MauE function could enable engineering of methylamine utilization in organisms that don't naturally possess this capability, potentially useful for bioremediation or biotechnological applications .

  • Advancing heterologous expression technologies: The successful expression of MADH in R. sphaeroides demonstrates the potential of this system for expressing complex proteins that cannot be functionally expressed in E. coli, opening possibilities for other challenging proteins .

  • Structure-function relationship studies: The system established for recombinant MauE expression provides a foundation for site-directed mutagenesis studies to investigate the molecular mechanisms of MauE function .

The R. sphaeroides expression system with the coxII promoter represents a valuable alternative to traditional E. coli-based systems for the expression of complex proteins, particularly those requiring specialized post-translational processing .

What technological advances might enhance our understanding of MauE function?

Several technological advances could significantly enhance our understanding of MauE function:

  • Cryo-electron microscopy: High-resolution structural determination of MauE, alone or in complex with interacting partners, would provide crucial insights into its mechanism of action and membrane topology .

  • Advanced protein tagging methods: Techniques that allow visualization of protein dynamics in living cells could help track the movement and interactions of MauE during MADH assembly .

  • Synthetic biology approaches: The modular nature of the mau gene cluster makes it amenable to synthetic biology approaches, where components can be systematically varied to determine minimal requirements and optimize function .

  • Computational modeling: Molecular dynamics simulations of MauE in membrane environments could provide insights into its conformational changes and interactions with MADH subunits .

  • Single-molecule techniques: Methods to study individual protein complexes could reveal transient interactions and conformational states of MauE during the MADH assembly process .

  • Cross-species comparative genomics: Systematic comparison of mau gene clusters and their expression across different bacterial species could identify conserved features essential for MauE function and species-specific adaptations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.