Recombinant Methylibium petroleiphilum 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Methylibium petroleiphilum 4-Hydroxybenzoate Octaprenyltransferase (UbiA)

Recombinant Methylibium petroleiphilum 4-hydroxybenzoate octaprenyltransferase (UbiA) is a membrane-bound enzyme critical for ubiquinone (coenzyme Q) biosynthesis. UbiA catalyzes the prenylation of 4-hydroxybenzoate (4-HB) with an octaprenyl group, forming 3-octaprenyl-4-hydroxybenzoate—a key intermediate in the ubiquinone-8 (UQ-8) pathway . This enzyme is encoded by the ubiA gene (UniProt ID: A2SMA7) in Methylibium petroleiphilum PM1, a Gram-negative bacterium renowned for biodegrading petroleum hydrocarbons and methyl tert-butyl ether (MTBE) .

Functional Role in Ubiquinone Biosynthesis

UbiA performs the second step in UQ-8 biosynthesis :

  1. Reaction: Prenylation of 4-HB with an octaprenyl group (C₄₀) derived from octaprenyl pyrophosphate.

  2. Product: 3-Octaprenyl-4-hydroxybenzoate, which undergoes decarboxylation and hydroxylation to form UQ-8 .

Key Functional Partners

Partner ProteinRole
Mpe_A2936 (UbiD homolog)Decarboxylates 3-octaprenyl-4-hydroxybenzoate
UbiXSynthesizes prenylated FMN cofactor for UbiD activity
UbiGCatalyzes O-methylation steps in UQ-8 biosynthesis

Biodegradation and Metabolic Versatility

  • M. petroleiphilum PM1 employs UbiA-derived UQ-8 for aerobic respiration during MTBE degradation, enabling energy generation in contaminated environments .

  • Transcriptomic studies show ubiA upregulation during growth on aromatic hydrocarbons (e.g., toluene, benzene), linking ubiquinone metabolism to pollutant detoxification .

Industrial and Biotechnological Potential

  • Recombinant UbiA is used in in vitro assays to study prenyltransferase mechanisms .

  • Applications in bioaugmentation for MTBE-contaminated groundwater remediation .

Expression and Purification Protocols

Recombinant UbiA is produced in E. coli with the following specifications :

  • Expression Vector: pET-based system.

  • Purification: Ni-NTA affinity chromatography (His-tag).

  • Purity: >90% (verified by SDS-PAGE).

  • Reconstitution: Requires glycerol (5–50%) for long-term stability.

Challenges and Future Directions

  • Thermostability: UbiA activity decreases after repeated freeze-thaw cycles .

  • Structural Resolution: No crystal structure exists for M. petroleiphilum UbiA; homolog structures (e.g., Archaeoglobus fulgidus UbiA) guide mechanistic studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your use.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself. Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiA; Mpe_A3743; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Target Names
ubiA
Target Protein Sequence
MSAAPAQAHPPSRLTLYRQLIRWDRPAGWLLLLWPTLGALWLAAGGFPGWHLLAVFTLGT VLMRSAGCCINDVADREFDRHVKRTAERPVTRGAVSVKEALAVGAVLALAAFALVLTTNA LTIALSFPALAVAVAYPYAKRCVAMPQAVLGVAFSFGIPMAFSAVRGGNGAWGLAALNAA VPWWAWGLLIGNLFWVLAYDTEYAMVDRDDDLKIGIKTSAITLGRHDVTAVMSFYQLYLL AWGAIGFWQGLGVAFAAGLAAAAVQVAWHHTLIRDRSRDGCFKAFRLNHWVGFAVFAGIV VDLGWRA
Uniprot No.

Target Background

Function
Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. This enzyme mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis. The process involves the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of ubiA and its role in bacterial metabolism?

The ubiA enzyme catalyzes a critical step in ubiquinone (coenzyme Q) biosynthesis, specifically the conversion of 4-hydroxybenzoate to 3-octaprenyl-4-hydroxybenzoate . This prenylation reaction is essential for the synthesis of ubiquinone, which serves as an electron carrier in the bacterial respiratory chain. The reaction involves the transfer of a long prenyl chain (octaprenyl in most bacteria) to the aromatic ring of 4-hydroxybenzoate .

Mechanistically, the enzyme requires Mg²⁺ for optimal activity, suggesting this divalent cation plays a role in stabilizing the enzyme-substrate complex or facilitating the catalytic reaction . In bacterial metabolism, this enzyme represents a crucial junction between aromatic compound metabolism and isoprenoid biosynthesis pathways. The resulting ubiquinone plays vital roles in energy generation through aerobic and anaerobic respiration, making ubiA indirectly essential for bacterial growth under multiple conditions .

What are the optimal storage and handling conditions for recombinant Methylibium petroleiphilum ubiA protein?

For optimal preservation of recombinant Methylibium petroleiphilum ubiA protein activity, store the lyophilized powder at -20°C/-80°C upon receipt . Working aliquots may be kept at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they significantly compromise protein integrity and activity .

For reconstitution, it is recommended to briefly centrifuge the vial before opening to ensure all contents are at the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Addition of 5-50% glycerol (final concentration) is recommended before aliquoting for long-term storage at -20°C/-80°C, with 50% being the standard concentration used by many manufacturers . The storage buffer typically consists of a Tris/PBS-based solution containing 6% Trehalose at pH 8.0, which helps maintain protein stability during freeze-thaw cycles and long-term storage .

What expression systems are most effective for producing recombinant Methylibium petroleiphilum ubiA protein?

E. coli expression systems have proven most effective for the recombinant production of Methylibium petroleiphilum ubiA protein . The bacterial expression host provides several advantages for this specific membrane protein: first, both organisms are gram-negative bacteria, sharing similar membrane composition and folding machinery; second, E. coli's rapid growth and high protein yields make it cost-effective for research purposes .

For optimal expression, consider these methodological approaches:

  • Codon optimization: Adapting the Methylibium petroleiphilum sequence to E. coli codon usage can significantly increase expression levels.

  • Fusion tags: The N-terminal His-tag not only facilitates purification but can also enhance protein solubility and stability during expression .

  • Induction conditions: For membrane proteins like ubiA, lower induction temperatures (16-25°C) and reduced inducer concentrations often yield better results by allowing proper membrane insertion and folding.

  • Specialized E. coli strains: C41(DE3) or C43(DE3) strains, designed for membrane protein expression, may provide superior yields compared to standard BL21(DE3) strains.

When working with membrane proteins like ubiA, inclusion of appropriate detergents during extraction and purification is essential to maintain native conformation and activity.

How can I assess the enzymatic activity of recombinant Methylibium petroleiphilum ubiA protein in vitro?

The enzymatic activity of recombinant Methylibium petroleiphilum ubiA can be assessed through several complementary approaches:

Standard Enzymatic Assay:

  • Prepare reaction mixture containing: purified ubiA protein (5-10 μg), 4-hydroxybenzoate substrate (0.1-1 mM), octaprenyl diphosphate or an appropriate prenyl donor (0.1-0.5 mM), MgCl₂ (5-10 mM), and appropriate buffer (typically 50-100 mM Tris-HCl, pH 7.5-8.0) .

  • Incubate at 30°C (the optimal growth temperature for Methylibium petroleiphilum) for 30-60 minutes .

  • Extract reaction products with organic solvent (ethyl acetate or hexane).

  • Analyze product formation by HPLC, LC-MS, or TLC systems capable of detecting prenylated aromatic compounds.

Coupled Enzyme Assays:
Connect the ubiA reaction to a detectable secondary reaction that produces a measurable signal, such as fluorescence or absorbance change.

Critical Considerations:

  • Since ubiA is a membrane protein, incorporation into liposomes or use of appropriate detergents (0.1-0.5% dodecyl maltoside or Triton X-100) may be necessary to maintain activity .

  • Always include Mg²⁺ in reaction buffers as it is required for optimal activity .

  • A negative control using heat-inactivated enzyme should be included to distinguish enzymatic activity from non-enzymatic reactions.

What methods can be used to study the membrane topology and insertion of ubiA protein?

Understanding the membrane topology of ubiA requires a multi-technique approach:

Computational Prediction Tools:
Begin with transmembrane prediction algorithms like TMHMM, Phobius, or MEMSAT to identify potential membrane-spanning regions. For Methylibium petroleiphilum ubiA, these typically predict 8-9 transmembrane helices characteristic of prenyl transferases in this family.

Experimental Validation Methods:

  • Cysteine Scanning Mutagenesis:

    • Generate single-cysteine variants throughout the protein sequence

    • Treat intact cells or membrane vesicles with membrane-impermeable sulfhydryl reagents

    • Differential labeling patterns reveal cytoplasmic vs. periplasmic/extracellular regions

  • Fusion Protein Analysis:

    • Create fusion constructs with reporter proteins (GFP or alkaline phosphatase) at various positions

    • Reporter activity depends on its cellular localization, revealing topology information

  • Protease Protection Assays:

    • Treat membrane preparations with proteases (e.g., trypsin, proteinase K)

    • Regions embedded in membrane or facing away from protease access remain protected

    • Analyze protection patterns using Western blotting with antibodies against different regions

  • Fluorescence Resonance Energy Transfer (FRET):

    • Introduce donor and acceptor fluorophores at key positions

    • FRET efficiency correlates with spatial proximity, helping map protein folding within membrane

For all these methods, protein incorporation into membranes can be enhanced by using E. coli strains optimized for membrane protein expression, and extraction should be performed with gentle detergents that maintain native membrane protein structure.

How does Methylibium petroleiphilum ubiA differ structurally and functionally from ubiA homologs in other bacterial species?

Methylibium petroleiphilum ubiA shares the core catalytic function of prenylation with homologs from other bacterial species, but exhibits several distinctive features that reflect its adaptation to Methylibium's unique metabolic capabilities:

Comparative Structural Analysis:

FeatureM. petroleiphilum ubiAE. coli ubiAS. paratyphi A ubiA
Length307 amino acids 290 amino acids290 amino acids
N-terminal extensionPresent (MSAAPAQAHPPSR) AbsentAbsent
Predicted TM helices8-988
Substrate specificityMultiple aromatic substrates possiblePrimarily 4-hydroxybenzoatePrimarily 4-hydroxybenzoate

The extended N-terminal region in M. petroleiphilum ubiA is particularly noteworthy, suggesting possible regulatory functions or interactions not present in other bacteria . Additionally, M. petroleiphilum's ability to metabolize aromatic compounds like dihydroxybenzoates as carbon sources suggests its ubiA might have broader substrate specificity than homologs from organisms like E. coli .

Functional Differences:
Methylibium petroleiphilum's ecological niche as a degrader of methyl tert-butyl ether and aromatic compounds suggests its ubiA may have evolved to function in environments with fluctuating oxygen levels and in the presence of various aromatic substrates . This contrasts with enteric bacteria like E. coli and Salmonella, whose ubiA enzymes operate in more consistent intestinal environments.

These differences make M. petroleiphilum ubiA an interesting comparative model for studying the evolution of prenyl transferases across diverse bacterial ecological niches.

What are the challenges in crystallizing membrane proteins like ubiA and what alternative structural determination methods can be employed?

Membrane proteins like ubiA present significant challenges for structural determination, particularly through crystallization. These challenges and alternative approaches include:

Key Crystallization Challenges:

  • Hydrophobicity and Instability: The transmembrane regions of ubiA are highly hydrophobic and often unstable when removed from their native membrane environment.

  • Detergent Selection: Finding the optimal detergent that maintains protein structure while allowing crystal contacts is largely empirical and often requires screening hundreds of conditions.

  • Conformational Heterogeneity: Membrane proteins frequently exist in multiple conformational states, complicating crystal formation.

  • Post-translational Modifications: If present, these can introduce heterogeneity that interferes with crystallization.

Alternative Structural Determination Methods:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Particularly valuable for membrane proteins as they can be studied in a more native-like environment

    • Does not require crystallization

    • Recent advances allow near-atomic resolution for proteins >100 kDa

    • For smaller proteins like ubiA (~35 kDa), use of antibody fragments or fusion partners may be necessary

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Solution NMR can provide structural details of smaller membrane proteins when incorporated into nanodiscs or micelles

    • Solid-state NMR can analyze proteins in lipid bilayers, providing information about dynamics and orientation

  • Hybrid Approaches:

    • Combine lower-resolution structural data with computational modeling

    • Evolutionary covariance analysis (e.g., using AlphaFold2) can predict contacts between residues

    • Cross-linking mass spectrometry can identify spatial proximities within the protein

  • X-ray Free Electron Laser (XFEL):

    • Allows use of microcrystals too small for conventional X-ray crystallography

    • "Diffraction before destruction" approach minimizes radiation damage

Each method has specific sample preparation requirements. For example, for cryo-EM, detergent selection criteria differ from crystallography, focusing more on background contrast than crystal packing considerations.

How can site-directed mutagenesis be used to identify catalytic residues in Methylibium petroleiphilum ubiA?

Site-directed mutagenesis represents a powerful approach for identifying catalytic and functionally important residues in Methylibium petroleiphilum ubiA. Based on structural homology with other prenyl transferases, several targeted approaches can be employed:

Rational Design Strategy:

  • Identify Conserved Motifs: Sequence alignment with characterized homologs from E. coli and other bacteria reveals two highly conserved aspartate-rich motifs (NDxxD) that typically coordinate Mg²⁺ and the prenyl diphosphate substrate in prenyl transferases .

  • Target Potential Metal-Binding Residues: Aspartate and glutamate residues within transmembrane regions are prime candidates for mutation, particularly those conserved across species. The requirement for Mg²⁺ makes these acidic residues critical targets .

  • Investigate Aromatic Substrate Binding: Aromatic and hydrophobic residues lining the putative substrate-binding pocket should be mutated to explore their role in 4-hydroxybenzoate recognition.

Methodological Approach:

  • Mutation Types:

    • Conservative substitutions (D→E, K→R) to probe the importance of specific functional groups

    • Alanine scanning to remove side chain functionality while maintaining protein folding

    • Charge reversals to drastically alter electrostatic properties (D→K, K→D)

  • Activity Assays:

    • Comparison of catalytic parameters (kcat, Km) between wild-type and mutant proteins

    • Analyze both 4-hydroxybenzoate and prenyl diphosphate binding separately

  • Structural Integrity Verification:

    • Circular dichroism to confirm proper folding

    • Limited proteolysis to assess structural changes

    • Thermal stability assays to detect destabilizing mutations

Expected Outcome Analysis:

Mutations that affect Mg²⁺ coordination will likely show activity that can be partially rescued by higher Mg²⁺ concentrations. Substrate binding mutations may exhibit altered Km values without necessarily affecting kcat. Complete loss of activity with preserved structure strongly suggests identification of a catalytic residue.

By systematically analyzing the effects of these mutations on enzyme kinetics, substrate specificity, and metal dependence, researchers can construct a detailed model of the active site architecture and catalytic mechanism of Methylibium petroleiphilum ubiA.

What insights can comparative genomics provide about the evolution of ubiA in Methylibium petroleiphilum compared to other bacterial species?

Comparative genomic analysis of ubiA across bacterial species reveals fascinating evolutionary patterns that reflect both conservation of essential function and adaptation to specific ecological niches:

Phylogenetic Context:
Methylibium petroleiphilum belongs to the Betaproteobacteria class within the Sphaerotilus-Leptothrix group, showing 93-96% 16S rRNA sequence identity with related genera . This phylogenetic positioning provides context for interpreting ubiA evolution in this organism compared to well-studied models like E. coli (Gammaproteobacteria).

Genomic Organization Patterns:
In many bacteria, ubiA exists within operons containing other ubiquinone biosynthesis genes. Analysis of the genomic neighborhood of M. petroleiphilum ubiA can reveal whether it shares this organization or has undergone rearrangements reflecting its unique metabolic capabilities as a facultative methylotroph capable of degrading aromatic compounds .

Sequence Conservation Analysis:

RegionConservation PatternFunctional Implication
Aspartate-rich motifsHighly conserved across all bacteriaEssential for catalytic activity
Transmembrane helicesConserved topology, variable sequenceStructural requirement with species-specific membrane composition adaptation
N-terminal extensionPresent in M. petroleiphilum, absent in many other bacteriaPossible regulatory adaptation specific to Methylibium metabolism
Substrate binding pocketVariable regions surrounding conserved coreMay reflect adaptation to different prenyl chain lengths or aromatic substrates

Selection Pressure Analysis:
Calculation of dN/dS ratios (nonsynonymous to synonymous substitution rates) across different bacterial lineages can identify regions under purifying selection (conserved function) versus those under positive selection (adaptive evolution). For M. petroleiphilum, we would expect positive selection in regions that might facilitate its unique metabolic capabilities, particularly in substrate recognition sites that might encounter diverse aromatic compounds .

Horizontal Gene Transfer Assessment:
Analysis of GC content, codon usage bias, and phylogenetic incongruence can determine whether ubiA in M. petroleiphilum was acquired horizontally, potentially contributing to its metabolic versatility in degrading environmental pollutants like methyl tert-butyl ether .

How does the substrate specificity of Methylibium petroleiphilum ubiA compare with homologous enzymes from other bacteria?

The substrate specificity of ubiA enzymes across bacterial species provides insights into metabolic adaptations and potential biotechnological applications:

Prenyl Chain Length Specificity:

Bacterial SpeciesNative Prenyl DonorChain LengthProduct
Methylibium petroleiphilumOctaprenyl diphosphateC403-octaprenyl-4-hydroxybenzoate
Escherichia coliOctaprenyl diphosphateC403-octaprenyl-4-hydroxybenzoate
Salmonella paratyphiOctaprenyl diphosphateC403-octaprenyl-4-hydroxybenzoate
Rhodobacter sphaeroidesNonaprenyl diphosphateC453-nonaprenyl-4-hydroxybenzoate

Aromatic Substrate Flexibility:
Methylibium petroleiphilum's ecological niche as a degrader of aromatic compounds suggests its ubiA may have broader substrate specificity than homologs from other bacteria . While the primary physiological substrate is 4-hydroxybenzoate, M. petroleiphilum's ability to grow on dihydroxybenzoates as sole carbon sources indicates potential enzymatic adaptations .

Experimental Assessment Approaches:

  • Competitive Substrate Assays:

    • Measure enzymatic activity with 4-hydroxybenzoate in the presence of structural analogs

    • Calculate IC50 values to determine relative binding affinities

  • Direct Activity Comparison:

    • Assay purified enzyme with alternative substrates (3-hydroxybenzoate, 2,4-dihydroxybenzoate, etc.)

    • Compare kinetic parameters (kcat/Km) to quantify substrate preference

  • Prenyl Donor Versatility:

    • Test activity with prenyl donors of varying chain lengths (geranyl, farnesyl, geranylgeranyl diphosphates)

    • Assess whether M. petroleiphilum ubiA maintains activity with shorter prenyl chains that might be more abundant in contaminated environments

The substrate specificity of M. petroleiphilum ubiA likely reflects evolutionary adaptations to its environmental niche, potentially offering advantages in metabolizing diverse aromatic compounds encountered in hydrocarbon-contaminated environments.

What role might ubiA play in the remarkable metabolic versatility of Methylibium petroleiphilum, particularly in its ability to degrade environmental pollutants?

Methylibium petroleiphilum's exceptional ability to degrade environmental pollutants, including the gasoline additive methyl tert-butyl ether (MTBE) and various aromatic compounds, suggests specialized metabolic adaptations in which ubiA may play crucial supporting roles:

Respiratory Chain Adaptations:
As a key enzyme in ubiquinone biosynthesis, ubiA contributes to the respiratory flexibility required by M. petroleiphilum when growing on challenging carbon sources . Ubiquinone serves as an electron carrier in both aerobic and anaerobic respiration, potentially supporting the varied redox conditions encountered during pollutant degradation.

Metabolic Network Integration:
M. petroleiphilum can utilize aromatic compounds including dihydroxybenzoates as sole carbon sources . This suggests a sophisticated metabolic network connecting aromatic compound catabolism with central metabolism. UbiA sits at a critical junction between:

  • Aromatic compound metabolism (utilizing 4-hydroxybenzoate)

  • Isoprenoid metabolism (utilizing octaprenyl diphosphate)

  • Energy generation (producing ubiquinone for respiration)

This strategic position makes ubiA potentially important for balancing carbon flux during growth on diverse substrates.

Adaptive Regulation Hypotheses:
The unique N-terminal extension in M. petroleiphilum ubiA (MSAAPAQAHPPSR) not found in other bacterial homologs could serve regulatory functions:

  • Substrate Channeling: The extension might facilitate interaction with aromatic compound degradation enzymes, creating efficient metabolic channeling.

  • Environmental Sensing: It could contain regulatory domains responsive to oxygen levels or aromatic compound presence.

  • Expression Control: The extension may affect protein stability or membrane insertion efficiency under different growth conditions.

Experimental Evidence Approach:
To test these hypotheses, researchers could:

  • Create truncation mutants removing the N-terminal extension to assess its impact on growth with different carbon sources

  • Perform comparative metabolomics between wild-type and ubiA-deficient strains grown on various pollutants

  • Examine ubiA expression levels during growth on different substrates using RT-qPCR or proteomics

  • Analyze respiration rates and redox status during pollutant degradation in wild-type versus ubiA mutant strains

Understanding ubiA's role in M. petroleiphilum's metabolic versatility could inform bioremediation strategies and potentially enable engineering of enhanced pollutant-degrading bacterial strains.

How could recombinant Methylibium petroleiphilum ubiA be utilized in biosynthetic pathways for production of novel prenylated compounds?

The prenylation capability of Methylibium petroleiphilum ubiA offers significant potential for biotechnological applications in synthesizing valuable prenylated compounds:

Enzyme Engineering Opportunities:

  • Substrate Scope Expansion:

    • Site-directed mutagenesis targeting the aromatic substrate binding pocket could generate ubiA variants accepting non-natural substrates

    • Directed evolution approaches using error-prone PCR followed by selection for desired activities could yield enzymes with novel specificities

  • Prenyl Chain Diversity:

    • Engineering M. petroleiphilum ubiA to accept shorter prenyl chains (C10-C20) could enable synthesis of prenylated compounds with improved water solubility

    • Combining engineered ubiA with isoprenoid pathway engineering could generate prenylated products with non-standard chain lengths

Potential High-Value Products:

Compound ClassRepresentative StructuresPotential Applications
Prenylated flavonoids8-prenylnaringenin, xanthohumolPharmaceuticals, nutraceuticals
Prenylated coumarinsOstruthin, umbellipreninAntimicrobials, anticancer agents
Prenylated stilbenesSchweinfurthinDrug development
Prenylated quinonesUbiquinone derivativesAntioxidants, electron carriers

Biosynthetic Pathway Integration:
M. petroleiphilum ubiA could be incorporated into engineered microbial chassis (E. coli, S. cerevisiae) alongside:

  • Aromatic substrate production pathways (shikimate pathway engineering)

  • Prenyl donor biosynthesis modules (MEP or mevalonate pathway)

  • Additional tailoring enzymes (hydroxylases, methyltransferases)

This would create complete biosynthetic routes to valuable natural products or non-natural derivatives.

Technical Implementation Considerations:
For successful biotechnological application, expression optimization is crucial: membrane-targeted expression systems, careful selection of detergents for extraction and reaction conditions, and potentially the development of whole-cell biocatalysts where the enzyme remains in its native membrane environment.

What experimental approaches would be most effective for studying the role of ubiA in Methylibium petroleiphilum's ability to degrade environmental pollutants?

Investigating ubiA's contribution to Methylibium petroleiphilum's remarkable pollutant degradation capabilities requires a multifaceted experimental approach:

Genetic Manipulation Strategies:

  • Gene Knockout/Knockdown:

    • Create ubiA deletion mutants or use inducible antisense RNA to reduce expression

    • Complement with wild-type or mutant variants to confirm phenotypes

    • Challenge with various pollutants (MTBE, BTEX compounds, alkanes) to assess growth defects

  • Conditional Expression Systems:

    • Develop tunable expression systems to control ubiA levels

    • Determine minimum expression required for different pollutant degradation activities

Physiological Characterization:

  • Respiratory Chain Analysis:

    • Measure ubiquinone content in wild-type vs. ubiA-deficient strains using HPLC-MS

    • Assess respiratory rates using oxygen electrodes during growth on different pollutants

    • Determine electron transport chain composition using spectroscopic methods

  • Metabolic Flux Analysis:

    • Use 13C-labeled substrates to track carbon flow through central metabolism

    • Compare flux distributions between wild-type and ubiA-deficient strains

    • Identify metabolic bottlenecks during pollutant degradation

Omics Integration:

ApproachTechniqueInformation Gained
TranscriptomicsRNA-SeqGene expression changes during pollutant degradation; regulatory networks
ProteomicsLC-MS/MSProtein abundance shifts; post-translational modifications
MetabolomicsGC-MS, LC-MSMetabolite profile alterations; pathway intermediates
Fluxomics13C labelingCarbon flow through different pathways; metabolic bottlenecks

Environmental Relevance Testing:

  • Microcosm Studies:

    • Create soil or groundwater microcosms contaminated with MTBE or other pollutants

    • Compare performance of wild-type vs. ubiA-modified strains in complex environments

    • Assess competitive fitness in mixed microbial communities

  • Biofilm Formation Analysis:

    • Evaluate whether ubiA affects biofilm formation on pollutant-containing surfaces

    • Compare biofilm matrix composition and structure

These approaches would provide comprehensive understanding of how ubiA and ubiquinone biosynthesis support M. petroleiphilum's exceptional metabolic versatility and pollutant degradation capabilities .

How can heterologous expression systems be optimized for maximum yield and activity of Methylibium petroleiphilum ubiA for research applications?

Optimizing heterologous expression of membrane proteins like Methylibium petroleiphilum ubiA presents unique challenges requiring systematic approaches to achieve maximum yield and activity:

Host Selection and Engineering:

  • Bacterial Expression Systems:

    • E. coli C41(DE3) and C43(DE3): Specifically designed for membrane protein overexpression

    • E. coli Lemo21(DE3): Allows tunable expression through rhamnose-inducible system

    • Consider co-expression with chaperones (GroEL/ES, DnaK/J) to improve folding

  • Alternative Expression Hosts:

    • Pseudomonas species: Closer phylogenetic relationship to Methylibium may provide better membrane integration

    • Cell-free systems: Allow direct control over expression conditions without cellular toxicity concerns

Expression Vector Optimization:

FeatureOptimization StrategyRationale
Promoter selectionTunable promoters (T7-lac, trc, arabinose)Control expression rate to prevent aggregation
Codon optimizationMatch codon usage to expression hostImprove translation efficiency
Fusion partnersN-terminal MBP, SUMO, or mistic fusionsEnhance solubility and membrane targeting
Purification tagsC-terminal His10 or twin-Strep tagsImproved purification while preserving N-terminal sequence
Signal sequencesPelB or OmpA leadersDirect protein to inner membrane

Culture Condition Optimization:

  • Growth Parameters:

    • Reduced temperature (16-25°C) during expression phase

    • Low inducer concentrations for slower, more controlled expression

    • Rich media supplemented with glycerol as carbon source

  • Membrane Protein-Specific Approaches:

    • Addition of specific phospholipids to growth media

    • Osmotic stress application to increase membrane production

    • Controlled aeration to balance growth and protein expression

Extraction and Purification Strategy:

  • Detergent Screening:

    • Mild detergents (DDM, LMNG, GDN) for initial extraction

    • Systematic detergent screening using thermostability assays

    • Consider lipid-like detergents (MNG amphipols) for activity preservation

  • Reconstitution Methods:

    • Proteoliposome formation using E. coli lipids

    • Nanodiscs for stable membrane environment

    • Lipid cubic phase for structural studies

Activity Preservation Approaches:
Stabilizing additives during purification and storage include glycerol (10-20%), cholesteryl hemisuccinate (CHS, 0.1%), and specific lipids matching the native membrane composition of Methylibium petroleiphilum.

Through systematic optimization of these parameters, researchers can achieve sufficient quantities of correctly folded, active Methylibium petroleiphilum ubiA for detailed biochemical and structural characterization.

What are the most promising future research directions for understanding the structure-function relationships of Methylibium petroleiphilum ubiA?

Future research on Methylibium petroleiphilum ubiA presents several high-potential directions for advancing our understanding of this enzyme's unique properties and functions:

Structural Biology Frontiers:

  • Determining the three-dimensional structure of M. petroleiphilum ubiA using cryo-EM or crystallography would provide unprecedented insights into its membrane topology and catalytic mechanism. The unique N-terminal extension represents a particularly interesting structural feature that distinguishes it from other bacterial homologs.

  • Investigating conformational changes during catalysis through techniques like hydrogen-deuterium exchange mass spectrometry or single-molecule FRET could reveal dynamic aspects of enzyme function not captured in static structures.

Mechanistic Enzymology:

  • Detailed kinetic analysis comparing wild-type and strategic mutants could elucidate the precise roles of conserved residues in substrate binding and catalysis.

  • Investigation of potential allosteric regulation mechanisms, particularly involving the unique N-terminal extension, might reveal how M. petroleiphilum modulates ubiquinone biosynthesis in response to environmental conditions.

Ecological and Evolutionary Context:

  • Comparative analysis of ubiA across the Methylibium genus and related bacteria adapted to different environmental niches could reveal how selection pressures shape enzyme properties.

  • Field studies examining ubiA expression and activity in contaminated environments would connect laboratory findings to real-world bioremediation applications.

Systems Biology Integration:

  • Incorporating ubiA into genome-scale metabolic models of M. petroleiphilum would allow prediction of its impact on cellular metabolism under various growth conditions.

  • Network analysis examining co-expression patterns with other genes could identify functional relationships between ubiquinone biosynthesis and pollutant degradation pathways.

These research directions, pursued with cutting-edge methodologies, would significantly advance our understanding of both fundamental prenyl transferase biochemistry and the specific adaptations that enable M. petroleiphilum's remarkable metabolic versatility.

What are the primary technical limitations currently hindering comprehensive characterization of Methylibium petroleiphilum ubiA, and how might they be addressed?

Several technical challenges currently limit our comprehensive understanding of Methylibium petroleiphilum ubiA. Addressing these limitations will require innovative methodological approaches:

Current Limitations and Potential Solutions:

  • Membrane Protein Expression and Purification:

    • Challenge: Obtaining sufficient quantities of properly folded, active enzyme

    • Solutions: Systematic screening of expression hosts, detergents, and stabilizing additives; exploration of novel membrane mimetics like nanodiscs, SMALPs (styrene-maleic acid lipid particles), or cell-free expression systems directly into liposomes

  • Structural Determination:

    • Challenge: Obtaining high-resolution structural data for a dynamic membrane protein

    • Solutions: Combining complementary approaches (cryo-EM, solid-state NMR, crosslinking mass spectrometry); utilizing AI-assisted structure prediction (AlphaFold2) as starting models; engineering conformationally stabilized variants through disulfide crosslinking

  • Enzymatic Assay Limitations:

    • Challenge: Low turnover rates and limited product detection sensitivity

    • Solutions: Development of coupled enzymatic assays with fluorescent readouts; application of sensitive analytical methods like UPLC-MS/MS; isotope labeling approaches for tracking prenyl transfer

  • Genetic Manipulation of Methylibium petroleiphilum:

    • Challenge: Limited genetic tools for this non-model organism

    • Solutions: Adaptation of CRISPR-Cas9 systems for genome editing; development of inducible expression systems specific to M. petroleiphilum; creation of reporter constructs to monitor in vivo activity

  • Substrate Availability:

    • Challenge: Limited commercial availability of long-chain prenyl diphosphates

    • Solutions: Enzymatic synthesis routes; collaboration with chemical biology groups; development of surrogate substrates with improved stability or detectability

Methodological Innovation Opportunities:

Technical LimitationInnovative ApproachExpected Outcome
Low enzyme stabilityMachine learning-guided stability engineeringVariants with improved conformational stability
Difficulty observing catalytic intermediatesTime-resolved spectroscopy/crystallographyCapture of transient catalytic states
Complex membrane integrationNative mass spectrometry of membrane complexesIdentification of protein-protein interactions
Limited in vivo activity dataDevelopment of ubiquinone biosensorsReal-time monitoring of ubiquinone production

Addressing these technical limitations through interdisciplinary approaches combining structural biology, chemical biology, synthetic biology, and advanced analytical techniques will significantly advance our understanding of this fascinating enzyme.

How might insights from Methylibium petroleiphilum ubiA research contribute to broader understanding of bacterial adaptations to environmental pollutants?

Research on Methylibium petroleiphilum ubiA has far-reaching implications for understanding bacterial adaptations to environmental pollutants and potentially enhancing bioremediation strategies:

Evolutionary Adaptation Mechanisms:
The study of M. petroleiphilum ubiA provides a window into how essential metabolic enzymes evolve to support specialized ecological functions. The unique features of this enzyme—particularly its N-terminal extension and potential substrate flexibility—may represent adaptations that enable survival in contaminated environments . Understanding these adaptations could reveal general principles about how core metabolic processes are modified to support specialized metabolic capabilities.

Respiratory Chain Adaptations:
As a key enzyme in ubiquinone biosynthesis, ubiA contributes to respiratory flexibility, which is crucial for bacteria degrading environmental pollutants under varying oxygen conditions . Insights from M. petroleiphilum ubiA research could illuminate how respiratory chain modifications support pollutant metabolism across diverse bacterial species, potentially identifying common adaptations that could serve as biomarkers for pollutant-degrading capacity in environmental samples.

Metabolic Network Integration:
The relationship between ubiquinone biosynthesis and aromatic compound degradation in M. petroleiphilum represents a fascinating case study in metabolic integration . Research on ubiA could reveal how bacteria balance competing metabolic demands when growing on challenging carbon sources, potentially identifying regulatory nodes that could be targeted to enhance pollutant degradation capabilities.

Translational Applications:

  • Bioremediation Enhancement:

    • Identification of rate-limiting steps in respiratory support of pollutant degradation

    • Development of monitoring tools to assess ubiquinone status as indicator of metabolic activity

    • Engineering of optimized strains with enhanced respiratory capacity

  • Biosensor Development:

    • Creation of ubiA-based reporter systems for detecting bioavailable aromatic pollutants

    • Use of ubiquinone biosynthesis gene expression as biomarker for active pollutant degradation

  • Ecological Monitoring:

    • Development of molecular tools targeting ubiA and related genes to identify and quantify pollutant-degrading bacteria in environmental samples

    • Correlation of ubiA sequence variants with degradation capabilities for different pollutant classes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.