Recombinant Methylibium petroleiphilum Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a particular tag type is required, please specify this during your order for preferential development.
Synonyms
mscL; Mpe_A0848; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Target Names
mscL
Target Protein Sequence
MSFFSEFKEFAVKGNVIDLAVGVIIGGAFGKIVDSIVGDLIMPIVSKLFGGLDFSNYYVG LAGQAAGLPLAEAKKAGAVFAYGNFITVALNFAILAFIIFLMIKQINRLKKDEPAAPPAP PAEDIVLLREIRDALKK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane stretch. It is believed to play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the genomic context of MscL in M. petroleiphilum compare to other bacterial species?

Based on genomic analysis of M. petroleiphilum PM1, the MscL gene would be located within the organism's ~4-Mb circular chromosome or its ~600-kb megaplasmid . The complete genome sequencing of M. petroleiphilum PM1 revealed 4,479 putative coding sequences (CDSs) . While the search results don't specifically mention MscL gene location, researchers working with this organism would need to examine the annotated genome to identify the MscL coding region. The genomic context may provide insights into potential co-regulation with other stress-response genes or membrane-associated proteins that contribute to M. petroleiphilum's remarkable environmental adaptability, including its ability to metabolize diverse carbon sources such as MTBE, ethanol, methanol, toluene, benzene, ethylbenzene, phenol, and C4 to C12 n-alkanes .

What expression systems are most effective for producing recombinant M. petroleiphilum MscL?

For recombinant expression of M. petroleiphilum MscL, researchers should consider the molecular genetic system established for studying M. petroleiphilum PM1. This system involves:

  • Efficient electroporation of PM1 cells (using Bio-Rad Gene Pulser electroporator set at 1.8 kV, 200 Ω, and 25 μF)

  • Targeted mutagenesis based on the Epicentre in vitro mutagenesis system

  • Complementation using pBBR1MCS-2 based vectors

When designing expression constructs, researchers should note that M. petroleiphilum requires a minimum fragment length of approximately 2 kb of host DNA for efficient homologous recombination-based mutagenesis . For heterologous expression, standard E. coli systems using pCR2.1 TOPO (Invitrogen) or pK18 vectors have been successfully employed for cloning M. petroleiphilum genes .

What are the optimal conditions for analyzing MscL channel activity in M. petroleiphilum?

For analyzing MscL channel activity in M. petroleiphilum, researchers should consider the following methodology:

  • Cell Culture Preparation:

    • Grow M. petroleiphilum PM1 in mineral salts medium supplemented with trace elements

    • Use defined carbon sources such as ethanol (790 mg/liter) for initial growth

    • Harvest cells during early log phase (OD595 = 0.2 to 0.4)

  • Electrophysiological Analysis:

    • Apply patch-clamp techniques similar to those used for other mechanosensitive channels

    • Record channel activity in native membranes or after reconstitution in lipid bilayers

    • Subject membranes to controlled tension to observe large-scale conformational transitions

  • Data Analysis Parameters:

    • Measure channel conductance under varying membrane tension conditions

    • Quantify open probability as a function of applied force

    • Compare activation thresholds with established mechanosensitive channels

When comparing results with other bacterial species, researchers should note that mechanosensitive channels generate robust current responses that can be clearly detected in electrophysiological recordings .

How can I genetically modify the MscL gene in M. petroleiphilum for functional studies?

To genetically modify the MscL gene in M. petroleiphilum, researchers can follow this established protocol based on successful genetic manipulation of other genes in this organism:

  • Fragment Amplification and Cloning:

    • Amplify a ~2.1-kb region containing the MscL gene using PCR with high-fidelity polymerase

    • Clone the PCR product into pCR2.1 TOPO vector (Invitrogen)

    • Verify correct cloning by sequencing

  • Insertion Mutagenesis:

    • Use the EZ-Tn5<SmQ> system for in vitro mutagenesis

    • Mix equimolar amounts (0.04 pmol) of plasmid and EZ-Tn5<SmQ> with transposase

    • Incubate for 2 hours at 37°C

    • Transform into E. coli DH5α cells and select on LB agar containing 50 μg/ml kanamycin and 50 μg/ml streptomycin

  • Verification and Transformation:

    • Verify transposon insertion by PCR and sequencing

    • Amplify the disrupted gene fragment with ~2 kb flanking regions

    • Transform into M. petroleiphilum by electroporation

    • Select transformants on 1/3× TSB agar containing 50 μg/ml streptomycin and 50 μg/ml spectinomycin

  • Confirmation of Recombination:

    • Verify correct insertion by PCR, expecting an increase in fragment size corresponding to the transposon insert

    • Confirm stability by testing antibiotic resistance after growth without selection for >20 generations

This approach has been successfully used for targeted gene disruption in M. petroleiphilum, as demonstrated with the mdpA gene .

What techniques are most effective for purifying recombinant MscL from M. petroleiphilum?

For purification of recombinant MscL from M. petroleiphilum, researchers should consider the following optimized protocol:

  • Cell Growth and Induction:

    • Culture cells in minimal salts media with appropriate carbon source

    • For inducible expression, consider systems that have shown success with other M. petroleiphilum proteins

  • Cell Lysis and Membrane Fraction Isolation:

    • Harvest cells by centrifugation at mid-log phase

    • Resuspend in buffer containing protease inhibitors

    • Lyse cells via French press or sonication

    • Separate membrane fraction by ultracentrifugation (100,000 × g for 1 hour)

  • Solubilization and Purification:

    • Solubilize membrane proteins using mild detergents (DDM, LDAO, or OG)

    • Utilize affinity chromatography with His-tagged constructs

    • Consider size exclusion chromatography as a final purification step

    • Verify protein purity by SDS-PAGE and Western blotting

  • Functional Verification:

    • Reconstitute purified protein into liposomes

    • Verify channel activity using patch-clamp electrophysiology

When working with membrane proteins like MscL, researchers should pay particular attention to detergent selection and concentration to maintain protein stability and functionality throughout the purification process.

How does MscL expression in M. petroleiphilum change under different environmental stressors?

The expression pattern of MscL in M. petroleiphilum likely responds to various environmental stressors, similar to other bacterial mechanosensitive channels. Although specific data on MscL expression is not provided in the search results, we can draw parallels with global transcriptome response studies in M. petroleiphilum:

Environmental ConditionExpected MscL ResponseRelated Observations in M. petroleiphilum
Osmotic stressUpregulationLikely involved in turgor pressure regulation
Growth on MTBEPotential co-regulationOther stress-response genes show 1.5-13 fold upregulation during MTBE metabolism
Aromatic compound exposureUnknownPM1 shows complex regulation of pathways involved in biodegradation of gasoline mixtures
Nutrient limitationPotential upregulationMay be part of general stress response

To study MscL expression changes experimentally, researchers could employ:

  • RT-qPCR analysis using gene-specific primers for MscL, following RNA extraction from cultures grown under different conditions

  • High-density oligonucleotide arrays similar to those used to examine gene expression profiles for ethanol and MTBE as growth substrates

  • Proteomic approaches to quantify MscL protein levels in membrane fractions

What is the relationship between MscL function and M. petroleiphilum's ability to metabolize complex compounds?

While direct evidence linking MscL function to M. petroleiphilum's metabolic capabilities is not provided in the search results, several hypotheses can be proposed:

  • Membrane Integrity Maintenance:
    MscL likely helps maintain membrane integrity during exposure to toxic compounds such as MTBE, toluene, benzene, and other hydrocarbons that M. petroleiphilum can metabolize . By acting as a pressure release valve, MscL may prevent membrane damage when these lipophilic compounds intercalate into the membrane.

  • Stress Response Coordination:
    The transcriptional regulation of MscL may be coordinated with metabolic pathways involved in degrading complex compounds. For example, when grown on MTBE, M. petroleiphilum shows upregulation of multiple pathways, including toluene monooxygenase, phenol hydroxylase, propane monooxygenase, and cyclohexanone monooxygenases .

  • Potential Metabolite Sensing:
    MscL may respond to membrane tension changes caused by specific metabolites, potentially serving as a sensory system to coordinate cellular responses to environmental pollutants.

To investigate these relationships experimentally, researchers could:

  • Create MscL knockout strains using the genetic techniques described earlier

  • Compare growth rates and metabolic capabilities of wild-type and MscL-deficient strains on various carbon sources

  • Measure membrane properties during metabolism of different compounds

How do mutations in key residues affect the gating properties of M. petroleiphilum MscL?

The gating properties of mechanosensitive channels are highly dependent on specific amino acid residues that sense membrane tension and facilitate conformational changes. For M. petroleiphilum MscL, researchers interested in structure-function relationships should consider the following approach:

  • Key Residue Identification:

    • Perform sequence alignment with well-characterized MscL channels from other bacteria

    • Focus on conserved residues known to be involved in tension sensing and gating

    • Identify M. petroleiphilum-specific residues that may confer unique properties

  • Site-Directed Mutagenesis Strategy:
    Based on the molecular genetic system established for M. petroleiphilum , researchers can:

    • Create point mutations in the cloned MscL gene

    • Introduce the mutated gene into M. petroleiphilum via homologous recombination

    • Express and purify the mutant channels for functional characterization

  • Functional Analysis of Mutants:

    • Compare channel activation thresholds using patch-clamp electrophysiology

    • Measure open probability and conductance under varying membrane tensions

    • Determine the effects of mutations on inactivation kinetics and subconductance states

Mutation TargetExpected EffectExperimental Approach
Transmembrane domainsAltered tension sensitivityPatch-clamp analysis of activation threshold
Pore-lining residuesChanged conductance or ion selectivitySingle-channel conductance measurements
Cytoplasmic domainsModified inactivation kineticsTime-resolved electrophysiology

How does M. petroleiphilum MscL compare structurally and functionally to MscL in other bacterial species?

While specific structural information about M. petroleiphilum MscL is not provided in the search results, comparative analysis would likely reveal both conserved features and species-specific adaptations:

  • Structural Conservation:

    • MscL channels typically consist of five identical subunits forming a homopentameric complex

    • Each subunit contains two transmembrane domains connected by a periplasmic loop

    • The first transmembrane domain typically lines the pore while the second interacts with the lipid bilayer

  • Functional Comparison:

    • The primary function of MscL as a pressure release valve is likely conserved in M. petroleiphilum

    • Activation thresholds may vary based on M. petroleiphilum's specific ecological niche

    • Given M. petroleiphilum's ability to metabolize diverse hydrocarbons , its MscL may show adapted responses to these compounds

  • Evolutionary Context:

    • M. petroleiphilum belongs to the Rubrivivax group (Comamonadaceae family) of the beta subclass of Proteobacteria

    • Phylogenetic analysis of MscL sequences could reveal how this channel has evolved in relation to M. petroleiphilum's unique metabolic capabilities

To conduct a comprehensive comparative analysis, researchers should clone and characterize M. petroleiphilum MscL alongside well-studied MscL proteins from model organisms such as E. coli and M. tuberculosis.

What insights can recombinant M. petroleiphilum MscL provide for understanding mechanosensation in environmental adaptation?

Recombinant M. petroleiphilum MscL represents a valuable model for understanding mechanosensation in bacteria adapted to contaminated environments:

  • Environmental Stress Adaptation:

    • M. petroleiphilum thrives in environments contaminated with gasoline components and MTBE

    • Its MscL may have evolved specific properties to deal with membrane stress caused by these pollutants

    • Studying these adaptations could reveal general principles of mechanosensation in extreme environments

  • Evolutionary Innovation:

    • M. petroleiphilum has unique metabolic capabilities, including complete metabolism of MTBE without accumulation of TBA

    • Its MscL may show co-evolutionary adaptations with metabolic pathways for environmental pollutants

    • Comparative genomic analysis could identify gene clusters that co-evolved with MscL

  • Ecological Significance:

    • M. petroleiphilum-like bacteria have been shown to be naturally occurring in MTBE-contaminated aquifers

    • Understanding how MscL contributes to survival in these environments could inform bioremediation strategies

    • Field studies could correlate MscL variants with specific environmental conditions

Research in this area would benefit from combining laboratory characterization of recombinant MscL with ecological sampling and bioinformatic analysis of natural M. petroleiphilum populations in contaminated sites.

What are common challenges in expressing and purifying functional recombinant M. petroleiphilum MscL?

Researchers working with recombinant M. petroleiphilum MscL may encounter several challenges throughout the expression and purification process:

  • Expression Challenges:

    • Low expression levels due to toxicity of overexpressed membrane protein

    • Inclusion body formation rather than membrane integration

    • Improper folding leading to non-functional channels

    Solution Strategies:

    • Use tightly controlled inducible promoters

    • Optimize growth temperature (typically lower temperatures improve folding)

    • Consider fusion tags that enhance membrane targeting

  • Genetic Manipulation Difficulties:

    • M. petroleiphilum is naturally resistant to many antibiotics

    • The organism readily forms spontaneous mutants against antibiotics

    • Expression of certain resistance genes in trans may be problematic

    Solution Strategies:

    • Use the specific genetic system established for M. petroleiphilum

    • Ensure minimum fragment length of ~2 kb for homologous recombination

    • Verify stable integration through multiple generations without selection

  • Purification Obstacles:

    • Maintaining protein stability during solubilization

    • Achieving sufficient purity while preserving function

    • Removing all detergent for functional studies

    Solution Strategies:

    • Screen multiple detergents for optimal solubilization

    • Use affinity chromatography followed by size exclusion

    • Consider native purification techniques to maintain protein-protein interactions

For researchers new to this field, we recommend starting with heterologous expression in E. coli before attempting homologous expression in M. petroleiphilum.

How can I optimize electrophysiological recordings of recombinant M. petroleiphilum MscL?

For optimal electrophysiological characterization of recombinant M. petroleiphilum MscL, consider the following methodological refinements:

  • Sample Preparation:

    • For native membrane recordings, prepare giant spheroplasts or right-side-out membrane vesicles

    • For reconstituted systems, optimize lipid composition to match M. petroleiphilum membrane properties

    • Control protein-to-lipid ratio carefully to avoid multiple channels in a single patch

  • Recording Configuration:

    • Use inside-out patch configuration for direct access to cytoplasmic domains

    • Apply negative pressure in a controlled manner using high-precision pressure clamps

    • Maintain consistent membrane patch size across experiments

  • Data Acquisition Parameters:

    • Sample at ≥20 kHz with appropriate filtering (typically 5 kHz)

    • Record at multiple holding potentials to characterize voltage dependence

    • Capture long recording periods to observe rare gating events

  • Analysis Considerations:

    • Employ event detection algorithms appropriate for high-conductance channels

    • Analyze subconductance states as they may provide insight into the gating mechanism

    • Plot open probability as a function of membrane tension for quantitative comparisons

When comparing MscL with other mechanosensitive channels such as MscS, note that they generate robust current responses in patch-clamp experiments that can be clearly distinguished based on conductance and gating kinetics .

What emerging technologies are most promising for studying M. petroleiphilum MscL structure-function relationships?

Several cutting-edge technologies show particular promise for advancing our understanding of M. petroleiphilum MscL:

  • Cryo-Electron Microscopy:

    • Enables determination of high-resolution structures without crystallization

    • Can capture multiple conformational states relevant to the gating cycle

    • Particularly valuable for membrane proteins like MscL that are challenging to crystallize

  • Advanced Molecular Dynamics Simulations:

    • Allow modeling of MscL behavior within realistic membrane environments

    • Can simulate responses to membrane tension at atomic resolution

    • Helpful for predicting effects of mutations before experimental validation

  • Single-Molecule FRET:

    • Enables real-time monitoring of conformational changes during channel gating

    • Can be combined with patch-clamp to correlate structural changes with function

    • Provides insights into dynamics not captured by static structural methods

  • In-Cell NMR:

    • Allows structural characterization in native-like environments

    • Can probe dynamics and interactions with cellular components

    • Provides atomic-level information about key residues during gating

  • CRISPR-Cas9 Genome Editing:

    • Could overcome limitations of current genetic manipulation techniques in M. petroleiphilum

    • Enables precise modification of MscL in its native genomic context

    • Facilitates creation of reporter fusions for in vivo localization and function studies

How might understanding M. petroleiphilum MscL contribute to bioremediation applications?

Understanding the structure and function of MscL in M. petroleiphilum could significantly advance bioremediation applications through several mechanisms:

  • Enhanced Strain Development:

    • MscL engineering could improve M. petroleiphilum's tolerance to high concentrations of pollutants

    • Strains with optimized MscL function might show increased survival in contaminated sites

    • Knowledge of how MscL responds to specific pollutants could guide genetic modifications

  • Biomarker Development:

    • MscL expression or modifications could serve as biomarkers for bacterial stress in contaminated environments

    • Monitoring MscL variants could help predict bioremediation efficacy in field applications

    • Correlations between MscL sequence and pollutant profiles could inform site assessment

  • Biosensor Applications:

    • MscL-based biosensors could detect membrane-active pollutants

    • Reporter systems linked to MscL could provide real-time monitoring of bacterial stress

    • Integration with field-deployable technologies could enable on-site contaminant assessment

M. petroleiphilum has already demonstrated efficacy in bioaugmentation field trials in gasoline-contaminated aquifers in California and Montana . Enhanced understanding of MscL's role in environmental adaptation could further improve these applications by optimizing bacterial survival and activity under challenging field conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.