Recombinant Methylibium petroleiphilum NADH-quinone oxidoreductase subunit K (nuoK)

What is Methylibium petroleiphilum and why is it significant for research?

Methylibium petroleiphilum PM1 is a Gram-negative, rod-shaped, motile, facultative aerobe belonging to the Betaproteobacteria class in the Sphaerotilus-Leptothrix group . It grows optimally at pH 6.5 and 30°C and possesses a 16S rRNA gene sequence with 93-96% identity to other genera in this group . This bacterium has gained significant scientific attention due to:

• Its ability to completely metabolize MTBE to CO2 without accumulating tert-butyl alcohol (TBA)

• Its broad metabolic capabilities, including growth on diverse carbon sources such as ethanol, methanol, toluene, benzene, ethylbenzene, phenol, and C4 to C12 n-alkanes

• Its successful application in bioaugmentation field trials in gasoline-contaminated aquifers in California and Montana

• Its genomic structure consisting of a ~4-Mb circular chromosome and a ~600-kb megaplasmid, containing 3,831 and 646 genes, respectively

The chemotaxonomic profile includes Q-8 as the major quinone, C16:1ω7c and C16:0 as major fatty acids, and a DNA G+C content of 69 mol% .

What is the structure and function of NADH-quinone oxidoreductase in Methylibium petroleiphilum?

NADH-quinone oxidoreductase (Complex I) in M. petroleiphilum functions as a proton-translocating enzyme (EC 1.6.99.5) that catalyzes the transfer of electrons from NADH to quinones in the respiratory chain . Key structural and functional features include:

• The enzyme comprises multiple subunits organized into membrane and peripheral domains

• The core complex is encoded by genes designated as nuo (NADH:ubiquinone oxidoreductase)

• The NuoK subunit is a small, highly hydrophobic membrane-embedded component

• The complex contains iron-sulfur clusters that mediate electron transfer

• It couples electron transport to proton translocation across the bacterial membrane

This enzyme is part of the primary energy conservation machinery in M. petroleiphilum, contributing to its ability to generate ATP when utilizing various carbon sources .

What are the characteristics of the NuoK subunit and its role in the NADH-quinone oxidoreductase complex?

The NuoK subunit (nuoK) in M. petroleiphilum is a small membrane protein with the following characteristics:

• It consists of 102 amino acid residues

• Contains multiple transmembrane helices that span the bacterial membrane

• The protein sequence is: MSITLGHYLSLGAMLFALSVIGIF LNRKNLIVLLMAIELMLLAVNLNFVAFSHYLGDMAGQVFVFFILTVAAAESAIGLAILVVLFRNRSTINVDELDALKG

• It is highly hydrophobic, consistent with its location in the membrane domain

• It plays a crucial role in the structural integrity of the proton-translocating machinery

The NuoK subunit is part of the membrane domain of Complex I and is believed to contribute to the formation of the proton translocation pathway .

What methods are used to produce and purify recombinant NuoK for research applications?

Production of recombinant NuoK from M. petroleiphilum typically involves:

Expression Systems:

• E. coli-based heterologous expression systems using specialized vectors

• Optimization of expression conditions to accommodate the hydrophobic nature of the protein

• Use of fusion tags to improve solubility and facilitate purification

Purification Methods:

• Detergent-based membrane protein extraction (using mild detergents)

• Affinity chromatography utilizing fusion tags (His-tag, GST, etc.)

• Size exclusion chromatography for final polishing

Storage Considerations:

• Storage buffer typically contains Tris-base with 50% glycerol optimized for protein stability

• Short-term storage at 4°C (up to one week) or long-term at -20°C or -80°C

• Avoiding repeated freeze-thaw cycles to maintain protein integrity

For researchers studying structure-function relationships, it is critical to verify protein folding and integrity through techniques such as circular dichroism spectroscopy before proceeding with functional assays.

What experimental approaches should researchers use to investigate NuoK function in Methylibium petroleiphilum?

Investigating NuoK function requires a multi-faceted approach:

Site-Directed Mutagenesis:

• Target conserved residues in transmembrane regions using PCR-based mutagenesis

• Employ homologous recombination techniques as described for E. coli nuoD studies

• Create a gene knockout and complement with mutated versions to assess phenotypic effects

Functional Assays:

• NADH:ubiquinone oxidoreductase activity assays using artificial electron acceptors

• Membrane potential measurements using fluorescent probes

• Proton translocation assays to assess the impact on proton pumping

Structural Studies:

• Membrane protein reconstitution into nanodiscs or liposomes

• Cryo-electron microscopy for structural determination

• Cross-linking studies to identify interaction partners within the complex

Comparative Transcriptomics:

• RNA-seq analysis comparing expression under different carbon sources (e.g., MTBE vs. ethanol)

• Identification of co-regulated genes to establish functional associations

These methodologies can provide complementary insights into both the structure and function of NuoK within the larger complex.

How can researchers compare the NuoK subunit from M. petroleiphilum with homologous proteins in other bacteria?

Comparative analysis of NuoK homologs should include:

Sequence Analysis:

• Multiple sequence alignment of NuoK proteins from diverse bacteria

• Identification of conserved residues across phylogenetic groups

• Analysis of sequence conservation patterns in membrane-spanning regions

Phylogenetic Analysis:

• Construction of phylogenetic trees to establish evolutionary relationships

• Correlation with metabolic capabilities (e.g., MTBE degradation)

• Comparison with other methylotrophs like Methylobacillus flagellatus

Structural Comparison:

• Homology modeling based on available structures (e.g., E. coli complex I)

• Identification of structural motifs conserved across species

• Analysis of species-specific structural features

Functional Complementation:

• Cross-species complementation experiments to test functional conservation

• Heterologous expression of M. petroleiphilum NuoK in model organisms

This comparative approach can reveal insights into structural and functional conservation across bacterial species that may inform experimental design.

What is the proposed relationship between NuoK function and MTBE degradation pathways in M. petroleiphilum?

The relationship between NuoK and MTBE degradation likely involves:

Energy Conservation:

• NADH-quinone oxidoreductase provides energy for MTBE degradation through ATP synthesis

• Complex I activity may be upregulated during growth on MTBE compared to more readily metabolizable substrates

Transcriptional Regulation:

• Microarray analysis shows differential expression patterns when cells are grown on MTBE versus ethanol

• Potential co-regulation with other MTBE degradation enzymes

Metabolic Integration:

• NuoK, as part of Complex I, may play a role in maintaining redox balance during MTBE metabolism

• The megaplasmid that contains genes essential for MTBE degradation may indirectly influence Complex I activity

Research Approach:

Understanding this relationship requires integration of genomic, transcriptomic, and biochemical data to establish the metabolic network connecting respiratory chain function to xenobiotic degradation.

How should researchers approach experimental contradictions when studying NuoK function?

When faced with contradictory data regarding NuoK function, researchers should:

Systematic Contradiction Analysis:

• Decompose experimental findings into atomic facts (specific observations)

• Identify pre-facts and post-facts related to each experiment

• Establish a timeline for experiments to identify temporal dependencies

• Use formal contradiction detection frameworks to pinpoint specific inconsistencies

Methodological Reconciliation:

• Analyze differences in experimental conditions (temperature, pH, strain variants)

• Compare protein preparation methods that might affect activity or structure

• Evaluate the sensitivity and specificity of different assay techniques

Data Analysis Frameworks:

• Employ natural language inference (NLI) models to score the likelihood of contradictions between experimental findings

• Use retrieval models to filter relevant fact pairs for comparison

• Apply statistical methods to determine if differences are significant

Experimental Design for Resolution:

• Design controlled experiments specifically targeting the contradiction

• Use orthogonal techniques to verify key findings

• Consider environmental or physiological factors that might explain discrepancies

This structured approach allows researchers to systematically address contradictions rather than dismissing conflicting results.

What structural insights have recently emerged about NuoK and related subunits in bacterial systems?

Recent structural studies have revealed:

Membrane Domain Organization:

• NuoK functions as part of a proton-translocation machinery in the membrane domain

• Each antiporter-like subunit contains two structural repeats comprising five transmembrane helices

• Transmembrane helices 7 and 12 are interrupted by extended loops in the middle of the membrane

Functional Motifs:

• The presence of conserved ionizable residues forming a continuous chain through the membrane domain

• Identification of p-bulge structures that may facilitate conformational changes during catalysis

• Potential interaction surfaces between NuoK and other membrane subunits

Research Methodologies:

• Cryo-electron microscopy of bacterial Complex I reconstituted in nanodiscs or liposomes

• Site-directed mutagenesis of conserved residues followed by activity assays

• Computational modeling of proton translocation pathways

These structural insights provide a foundation for understanding the molecular mechanisms of energy transduction in which NuoK participates.

How can knowledge of NuoK contribute to developing improved MTBE bioremediation strategies?

Understanding NuoK function can enhance MTBE bioremediation through:

Bioengineering Applications:

• Design of more efficient M. petroleiphilum strains with optimized energy metabolism

• Development of biosensors to monitor MTBE degradation activity in situ

• Engineering of synthetic microbial consortia for enhanced bioremediation

Field Application Strategies:

• Optimization of environmental conditions to support Complex I activity during bioremediation

• Monitoring of key biomarkers including nuoK expression to assess metabolic activity

• Integration with other treatment technologies for synergistic effects

Experimental Approach for Development:

• Characterize the performance of nuoK variants under field-relevant conditions

• Conduct mesocosm studies comparing wild-type and engineered strains

• Develop molecular diagnostic tools targeting nuoK and related genes to monitor bioremediation progress

The successful field trials using M. petroleiphilum in California and Montana provide proof-of-concept for applying fundamental knowledge of its metabolism to practical bioremediation challenges .