Recombinant Methylibium petroleiphilum Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requests. Please indicate your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All of our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our products is dependent on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; Mpe_A1389; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Target Names
lgt
Target Protein Sequence
MLIHPQFDPVALELGPLAIHWYGLTYLVAFGLFLWLASLRVQHSPFRETGWTRRDVEDLL FYGVLGVIIGGRLGYVLFYKPGYYAAHPLEVFEVWKGGMAFHGGLLGVIGAMALFARTRG RRWLEVTDLIAPCVPTGLASGRIGNFINGELWGRAADPSLPWAMVYPQSGSEIPRHPSPL YQFALEGLLLFVVLWLYARKPRATGQVSGAFLVGYGVLRFIAEYFREPDGFLGLLALGMS MGQWLCVPMVAAGVALWVWAGRRA
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) from *Methylibium petroleiphilum* catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This reaction represents the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Methylibium petroleiphilum and what makes it significant for research?

Methylibium petroleiphilum is a Gram-negative, rod-shaped, motile, non-pigmented, facultative aerobe that grows optimally at pH 6.5 and 30°C. It was isolated for its ability to completely degrade the gasoline additive methyl tert-butyl ether (MTBE), making it environmentally significant. Taxonomically, it belongs to the class Betaproteobacteria in the Sphaerotilus-Leptothrix group, with 16S rRNA gene sequence identity to other genera in this group ranging from 93 to 96% . The bacterium is notable for being a facultative methylotroph that can use methanol as a sole carbon source while also growing heterotrophically on substrates like ethanol, toluene, benzene, ethylbenzene, and dihydroxybenzoates . The strain PM1T (ATCC BAA-1232T=LMG 22953T) is the type strain for this species, which represents a new genus and species based on morphological, physiological, biochemical, and genetic information .

Its significance for research extends beyond environmental remediation to include:

  • Model organism for studying bacterial degradation pathways

  • Subject for investigating lateral gene transfer mechanisms

  • System for exploring the regulation of multiple biodegradation pathways in beta-proteobacteria

  • Potential source of novel enzymes including lipoproteins and their processing enzymes

What is prolipoprotein diacylglyceryl transferase (lgt) and its role in bacterial systems?

Prolipoprotein diacylglyceryl transferase (Lgt) is an integral membrane enzyme that catalyzes the first reaction in the three-step post-translational lipid modification pathway for bacterial lipoprotein biosynthesis . This enzyme transfers a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of the conserved cysteine residue in the lipobox of prolipoproteins . This modification is essential for bacterial survival, as evidenced by the fact that deletion of the lgt gene is lethal to most Gram-negative bacteria .

The critical nature of Lgt stems from the vital functions of bacterial lipoproteins, which include:

  • Maintenance of cell envelope architecture

  • Insertion and stabilization of outer membrane proteins

  • Nutrient uptake and transport

  • Adhesion, invasion, and virulence factors

In M. petroleiphilum, the lgt gene would be expected to function similarly, though with possible adaptations related to this organism's unique environmental niche and metabolic capabilities.

How does the genetic structure of M. petroleiphilum influence expression of genes like lgt?

The genome of M. petroleiphilum PM1 consists of a chromosome with a G+C content of 69.2% and a large plasmid with a G+C content of 66% . This high G+C content can significantly influence the expression of genes, including those encoding enzymes like Lgt, particularly when attempting recombinant expression.

Genomic analysis reveals that the plasmid appears to carry genetic information responsible for PM1's ability to degrade MTBE, while comparative genomic hybridization experiments with PM1-like MTBE-degrading environmental isolates showed the plasmid was highly conserved (approximately 99% identical) . The distribution patterns of insertion sequence elements, the distributions of best BLASTP hits among major phylogenetic groups, and the G+C content differences between chromosome and plasmid suggest lateral gene transfer has played a significant role in shaping this bacterium's genetic capabilities .

For researchers working with lgt and other M. petroleiphilum genes, these genomic characteristics necessitate consideration of:

  • Codon optimization when designing expression systems

  • Potential regulatory elements that may differ from model organisms

  • The possibility of recently acquired genes having different expression patterns

What are the structural characteristics of Lgt and how might they compare between E. coli and M. petroleiphilum?

While the crystal structure of M. petroleiphilum Lgt has not been specifically reported in the provided search results, the structure of E. coli Lgt has been determined at 1.9 Å and 1.6 Å resolution in complex with phosphatidylglycerol and palmitic acid inhibitor, respectively . These structures revealed two binding sites and supported previous structure-function relationships of Lgt .

Key structural insights from E. coli Lgt that may inform research on M. petroleiphilum Lgt include:

  • The presence of critical residues such as Arg143 and Arg239 that are essential for diacylglyceryl transfer, as demonstrated through complementation results of lgt-knockout cells with different mutant Lgt variants .

  • A mechanism whereby substrate and lipid-modified lipobox-containing peptide product enter and leave the enzyme laterally relative to the lipid bilayer .

For M. petroleiphilum Lgt research, a comparative homology modeling approach could identify conserved catalytic residues and structural features. Differences in substrate specificity might reflect adaptations to the unique membrane composition of M. petroleiphilum, which has C16:1ω7c and C16:0 as major fatty acids .

What methodologies are recommended for studying lateral gene transfer in the context of lgt in M. petroleiphilum?

Studying lateral gene transfer (LGT) involving the lgt gene in M. petroleiphilum requires a multifaceted approach due to the complex nature of horizontal gene movement. Based on the search results, recommended methodologies include:

Table 1: Comparative Analysis Approaches for Detecting LGT in M. petroleiphilum lgt

ApproachMethodologyKey IndicatorsAdvantagesLimitations
Sequence CompositionG+C content analysisDeviation from genome average (69.2% chromosome, 66% plasmid)Simple, fastLess sensitive for ancient transfers
Phylogenetic AnalysisGene vs. species tree comparisonTopological incongruenceRobust for detecting distant transfersComputationally intensive
Synteny AnalysisExamination of gene order conservationDisruption of conserved gene blocksDetects recent transfersRequires well-annotated genomes
Mobile Element DetectionIdentification of nearby IS elementsPresence of transposases, integrasesDirect evidence of mobilityMay miss older transfer events
Recombination AnalysisBreakpoint identificationWithin-gene breakpoints (ORBs)Can detect partial gene transfersComplex statistical analysis required

How can transcriptomic approaches be utilized to understand lgt expression in different growth conditions?

Transcriptomic approaches offer powerful insights into how genes like lgt are regulated under different conditions. Based on the methodologies used for studying M. petroleiphilum , the following approaches are recommended:

  • High-Density Whole-Genome cDNA Microarrays: These can be employed to investigate substrate-dependent gene expression patterns, comparing lgt expression across different growth substrates (e.g., MTBE vs. ethanol) .

  • Microarray Design and Analysis: For M. petroleiphilum, microarray design can follow the approach used in previous studies where 2-9 60-base oligonucleotides (probes) were selected for each CDS based on length, with probes replicated in triplicate on each chip to represent technical replicates .

  • RT-qPCR Validation: Confirmation of transcript levels should be performed using reverse transcription-quantitative PCR (RT-qPCR) analysis of RNA samples extracted from cultures grown under different conditions .

  • RNA-Seq Analysis: While not specifically mentioned in the search results, contemporary approaches would include RNA-Seq for more comprehensive and sensitive transcriptome profiling, allowing detection of novel transcripts and alternative splicing events.

Implementation protocol based on previous M. petroleiphilum studies:

a) Grow M. petroleiphilum cultures under different conditions (e.g., with different carbon sources or stress conditions)
b) Extract total RNA using established protocols
c) Convert RNA to cDNA using random hexamers and reverse transcriptase
d) Amplify cDNA using gene-specific primers for lgt and related genes
e) Analyze expression patterns and identify regulatory networks affecting lgt expression

This approach would allow researchers to determine not only how lgt expression responds to different growth substrates but also its potential co-regulation with other genes involved in lipoprotein processing or membrane integrity.

What is the recommended expression system for producing recombinant M. petroleiphilum Lgt?

Expressing recombinant M. petroleiphilum Lgt presents challenges due to its nature as an integral membrane protein and the high G+C content (approximately 69%) of the source organism . Based on successful approaches with other bacterial membrane proteins and Lgt from E. coli , the following expression system recommendations can be made:

  • Host Selection: E. coli C41(DE3) or C43(DE3) strains, which are engineered for membrane protein expression, are recommended as primary expression hosts. These strains contain mutations that prevent toxicity associated with membrane protein overexpression.

  • Vector Design:

    • Use vectors with tunable expression, such as those with the T7lac promoter

    • Include a C-terminal His6-tag for purification, positioned to minimize interference with membrane insertion

    • Consider fusion partners like MBP (maltose-binding protein) that can enhance solubility

  • Codon Optimization: Due to the high G+C content of M. petroleiphilum (69.2% for chromosome), codon optimization for E. coli expression is essential to avoid translational stalling and poor protein yields.

  • Expression Conditions:

    • Induction with low IPTG concentrations (0.1-0.5 mM) at reduced temperatures (16-25°C)

    • Extended expression periods (16-24 hours) to allow proper membrane insertion

    • Supplementation with phospholipids, particularly phosphatidylglycerol, which is a substrate for Lgt

  • Membrane Fraction Preparation: Gentle lysis methods such as French pressure cell or sonication in buffer containing glycerol and protease inhibitors to preserve protein integrity.

For researchers requiring higher yields or struggling with E. coli expression, alternative hosts such as Pichia pastoris or cell-free expression systems coupled with nanodisc technology could be considered, though these would require significant protocol optimization.

What methodologies are effective for purifying and characterizing recombinant M. petroleiphilum Lgt?

Purification and characterization of recombinant M. petroleiphilum Lgt requires specialized approaches for membrane proteins. The following methodology is recommended based on successful approaches with E. coli Lgt and general membrane protein techniques:

Purification Protocol:

  • Membrane Isolation: Fractionate cell lysates through differential centrifugation to isolate membrane fractions.

  • Solubilization Screening: Test multiple detergents (DDM, LDAO, DMNG) at various concentrations to identify optimal solubilization conditions.

  • Affinity Chromatography: Purify using Ni-NTA affinity chromatography with detergent-containing buffers.

  • Size Exclusion Chromatography: Apply further purification through size exclusion chromatography to remove aggregates and obtain homogeneous protein preparations.

  • Protein Quality Assessment: Verify purity through SDS-PAGE and Western blotting, and assess protein folding using circular dichroism spectroscopy.

Characterization Methodologies:

  • Functional Assays: Assess enzymatic activity using a GFP-based in vitro assay similar to that used for E. coli Lgt, correlating activities with structural observations .

  • Substrate Specificity Analysis: Determine specificity using various phospholipid substrates and lipobox-containing peptides.

  • Thermal Stability Assessment: Employ differential scanning fluorimetry to evaluate protein stability under various conditions.

  • Structural Studies: If high-purity protein can be obtained, pursue crystallization trials or cryo-EM studies to determine structure, potentially in complex with phosphatidylglycerol similar to E. coli Lgt studies .

Table 2: Recommended Detergents for M. petroleiphilum Lgt Purification

DetergentConcentration RangeAdvantagesConsiderations
DDM (n-Dodecyl-β-D-maltopyranoside)0.5-1% for solubilization; 0.02-0.05% for purificationGentle, maintains activity of many membrane proteinsForms larger micelles, may interfere with some assays
LDAO (Lauryldimethylamine oxide)0.5-1% for solubilization; 0.05-0.1% for purificationForms smaller micelles, good for crystallizationCan be harsher on protein stability
DMNG (Decyl Maltose Neopentyl Glycol)0.5-1% for solubilization; 0.01-0.05% for purificationStabilizes membrane proteins, smaller micellesMore expensive, less established protocols
Digitonin0.5-1% for solubilization; 0.1-0.2% for purificationVery mild, preserves protein-protein interactionsVariable quality, poor for mass spectrometry

How can site-directed mutagenesis be designed to study structure-function relationships in M. petroleiphilum Lgt?

Site-directed mutagenesis is a powerful approach for investigating structure-function relationships in proteins like Lgt. Based on complementation studies with E. coli Lgt that identified critical residues such as Arg143 and Arg239 , the following methodology for M. petroleiphilum Lgt is recommended:

Mutagenesis Strategy:

  • Target Residue Selection:

    • Focus on putative catalytic residues (Arg, His, and Asp/Glu residues) based on homology with E. coli Lgt

    • Target conserved residues in predicted transmembrane domains

    • Investigate residues in predicted substrate binding pockets

  • Mutation Design:

    • Conservative substitutions (e.g., Arg→Lys, Asp→Glu) to test charge requirements

    • Non-conservative substitutions (e.g., Arg→Ala) to completely eliminate side chain contributions

    • Cysteine substitutions for subsequent chemical modification studies

  • Primer Design for PCR-Based Mutagenesis:

    • Design primers with 15-20 bp flanking regions on each side of the mutation

    • Account for the high G+C content (69.2%) of M. petroleiphilum genes by:

      • Including DMSO in PCR reactions (5-10%)

      • Using specialized polymerases for GC-rich templates

      • Designing primers with balanced G+C content at ends

Functional Assessment of Mutants:

Table 3: Priority Residues for Site-Directed Mutagenesis in M. petroleiphilum Lgt Based on E. coli Lgt Data

Residue TypeFunctionRecommended SubstitutionsExpected Outcome
Conserved Arg (equivalent to E. coli Arg143, Arg239)Critical for diacylglyceryl transferArg→Lys, Arg→Ala, Arg→GluComplete loss of function with Ala/Glu; potential partial activity with Lys
Conserved HisPotential role in substrate binding or catalysisHis→Ala, His→Asn, His→PheVariable effects depending on exact role; Asn maintains H-bonding potential
Membrane-interface residuesSubstrate entry/exit pathwayHydrophobic→Ala, Polar→AlaAltered substrate specificity or transfer rates
Phospholipid binding pocketSubstrate recognitionConservative substitutions reducing side chain sizeAltered substrate preference or binding kinetics

How can transcriptomic data be analyzed to identify regulatory networks involving lgt in M. petroleiphilum?

Analyzing transcriptomic data to uncover regulatory networks involving lgt requires sophisticated bioinformatic approaches. Based on the methods used in previous M. petroleiphilum studies , the following analytical framework is recommended:

  • Differential Expression Analysis:

    • Compare expression levels of lgt across different growth conditions (e.g., MTBE vs. ethanol as carbon sources)

    • Apply appropriate statistical methods (e.g., limma for microarray data or DESeq2/edgeR for RNA-Seq data)

    • Establish significance thresholds (typically adjusted p-value < 0.05 and fold change > 2)

  • Co-expression Network Construction:

    • Identify genes with expression patterns similar to lgt using Pearson or Spearman correlation

    • Build co-expression networks using algorithms like WGCNA (Weighted Gene Correlation Network Analysis)

    • Visualize networks using tools such as Cytoscape to identify potential regulatory hubs

  • Pathway Enrichment Analysis:

    • Analyze functionally related gene sets that are co-expressed with lgt

    • Apply gene set enrichment analysis (GSEA) to identify overrepresented pathways

    • Focus on membrane biogenesis, lipid metabolism, and stress response pathways

  • Transcription Factor Binding Site Analysis:

    • Examine promoter regions of co-expressed genes for shared regulatory motifs

    • Use tools like MEME or JASPAR to identify potential transcription factor binding sites

    • Validate predictions through methods like ChIP-seq or reporter gene assays

  • Integration with Proteomics Data:

    • Correlate transcriptomic findings with proteomic data when available

    • Identify post-transcriptional regulatory mechanisms through RNA-protein comparisons

This analytical approach has been successfully applied to understand the MTBE degradation pathway in M. petroleiphilum, where transcriptome analysis revealed links between MTBE metabolism and metabolism of other aromatic compounds present in gasoline mixtures .

What approaches can be used to resolve contradictions in experimental data regarding Lgt function?

Contradictions in experimental data are common in advanced research fields. For resolving discrepancies related to M. petroleiphilum Lgt function, the following structured approach is recommended:

  • Methodological Validation and Standardization:

    • Critically evaluate experimental conditions across contradictory studies

    • Standardize key parameters (protein purification methods, assay conditions, substrate preparations)

    • Implement controls that can identify method-dependent artifacts

  • Cross-Validation with Multiple Techniques:

    • Apply complementary methodologies to test the same hypothesis

    • For example, combine in vitro enzymatic assays with in vivo complementation studies

    • Validate functional predictions with structural data when possible

  • Contradiction Detection Framework:

    • Implement a systematic approach similar to that described for contradiction detection using linguistic rules and machine learning models

    • Categorize contradictions by type (numerical mismatch, antonymy, logical inconsistency)

    • Generate testable hypotheses to resolve each contradiction type

  • Statistical Meta-Analysis:

    • Pool data from multiple studies for increased statistical power

    • Apply hierarchical models that account for between-study variability

    • Identify moderator variables that might explain contradictory outcomes

  • Experimental Design for Contradiction Resolution:

    • Design critical experiments specifically targeted at resolving the contradiction

    • Include factorial designs that systematically vary key parameters identified in contradictory studies

    • Implement blinded analysis protocols to minimize confirmation bias

When applying this framework, researchers should consider potential sources of variation specific to membrane proteins like Lgt, including:

  • Detergent effects on protein conformation and activity

  • Lipid composition of the experimental system

  • Expression host effects on post-translational modifications

  • Differences in purification protocols that might select for specific protein conformations

How can computational approaches predict substrate specificity of M. petroleiphilum Lgt?

Computational prediction of substrate specificity for M. petroleiphilum Lgt can leverage both sequence-based and structure-based approaches. The following methodological framework is recommended:

Sequence-Based Prediction Approaches:

  • Multiple Sequence Alignment (MSA) Analysis:

    • Align M. petroleiphilum Lgt with characterized Lgt proteins from diverse bacteria

    • Identify conserved motifs associated with substrate recognition

    • Apply methods such as ConSurf to map conservation onto structural models

  • Machine Learning Classification:

    • Train models on known Lgt proteins with characterized substrate preferences

    • Use features such as amino acid composition, physicochemical properties, and secondary structure

    • Apply cross-validation to assess prediction accuracy

  • Substrate Docking Simulations:

    • Generate homology models of M. petroleiphilum Lgt based on the E. coli Lgt crystal structure

    • Dock various phospholipid substrates using tools like AutoDock Vina or Glide

    • Analyze binding energies and key interaction residues

  • Molecular Dynamics Simulations:

    • Perform extended simulations (>100 ns) of Lgt in a lipid bilayer environment

    • Analyze protein dynamics, particularly of putative substrate entry/exit pathways

    • Identify stable binding poses and calculate free energy of binding

Table 4: Computational Tools for Predicting M. petroleiphilum Lgt Substrate Specificity

ApproachRecommended ToolsRequired InputExpected OutputsComputational Resources
Homology ModelingSWISS-MODEL, Modeller, I-TASSERLgt amino acid sequence3D structural modelLow to Medium
Conservation AnalysisConSurf, Evolutionary TraceMSA of Lgt homologsMapping of conserved residues on structureLow
Molecular DockingAutoDock Vina, Glide, HADDOCKProtein structure, substrate structuresBinding poses, interaction energiesMedium
Molecular DynamicsGROMACS, NAMD, AMBERProtein-substrate complex in membraneDynamic interactions, binding stabilityHigh
Machine LearningSVM, Random Forest, Deep Neural NetworksFeature vectors from sequence/structureSubstrate classification, specificity predictionsMedium to High

Experimental Validation of Computational Predictions:

To validate computational predictions, researchers should:

  • Generate point mutations at predicted substrate-binding residues

  • Express and purify mutant proteins

  • Conduct substrate competition assays with various phospholipids

  • Compare experimental results with computational predictions to refine models

This iterative approach combining computational prediction with experimental validation has proven effective for characterizing enzyme specificity in other systems and would be particularly valuable for understanding the unique adaptations of M. petroleiphilum Lgt to its environmental niche.

What are the major challenges in studying recombinant M. petroleiphilum Lgt and how might they be addressed?

Research on recombinant M. petroleiphilum Lgt faces several significant challenges due to the nature of the protein and the organism. Based on the information from the search results, these challenges and potential solutions include:

  • High G+C Content Expression Challenges:

    • Challenge: The high G+C content (69.2% for chromosome, 66% for plasmid) of M. petroleiphilum can lead to poor expression in common host systems.

    • Solution: Implement codon optimization strategies specifically designed for high G+C content genes, use specialized expression hosts like Pseudomonas species that naturally handle high G+C content, or employ cell-free expression systems that bypass transcriptional and translational limitations.

  • Membrane Protein Solubility and Stability:

    • Challenge: As an integral membrane enzyme, Lgt presents difficulties in expression, purification, and maintaining native conformation.

    • Solution: Screen multiple detergents and lipid nanodisc systems, employ GFP fusion reporters to monitor proper folding, and utilize thermal shift assays to identify stabilizing conditions.

  • Functional Assay Development:

    • Challenge: Developing sensitive and specific assays for Lgt activity that accurately reflect native function.

    • Solution: Adapt the GFP-based in vitro assay used for E. coli Lgt , develop mass spectrometry-based assays to directly monitor substrate conversion, or establish complementation systems in conditional lgt mutants.

  • Structural Characterization:

    • Challenge: Obtaining structural information specific to M. petroleiphilum Lgt beyond homology modeling based on E. coli structures .

    • Solution: Pursue cryo-EM approaches that have proven successful for other membrane proteins, explore lipidic cubic phase crystallization, or apply hydrogen-deuterium exchange mass spectrometry for mapping functional regions.

  • Understanding Ecological Relevance:

    • Challenge: Connecting molecular function of Lgt to the ecological niche of M. petroleiphilum as an MTBE-degrading organism.

    • Solution: Conduct comparative transcriptomics under various environmental conditions , explore the impacts of Lgt mutations on membrane integrity during MTBE metabolism, and investigate potential co-regulation with MTBE degradation pathways.

How might future research directions expand our understanding of M. petroleiphilum Lgt in relation to bioremediation applications?

Future research on M. petroleiphilum Lgt has significant potential to expand our understanding of bacterial adaptation to environmental pollutants and enhance bioremediation applications. Promising research directions include:

  • Lipoprotein-Mediated Environmental Adaptation:

    • Investigate how Lgt-modified lipoproteins contribute to M. petroleiphilum's remarkable ability to metabolize diverse pollutants including MTBE, toluene, benzene, and other hydrocarbons .

    • Explore potential specialized lipoproteins involved in substrate uptake or detoxification processes.

  • System-Level Integration:

    • Develop comprehensive models integrating transcriptomic, proteomic, and metabolomic data to understand how Lgt function coordinates with the MTBE degradation pathway located on the megaplasmid .

    • Investigate potential lipoprotein involvement in the various monooxygenase systems (toluene monooxygenase, phenol hydroxylase, propane monooxygenase) that were upregulated in MTBE-grown cells .

  • Engineered Systems for Enhanced Bioremediation:

    • Explore whether optimized Lgt function could enhance cell surface properties to improve cellular adherence in bioremediation systems.

    • Investigate the potential for engineered lipoproteins to enhance pollutant uptake or degradation rates.

  • Evolutionary Studies:

    • Examine how Lgt and the lipoprotein maturation pathway may have co-evolved with pollutant degradation capabilities, particularly in light of evidence that the plasmid carrying MTBE degradation genes was recently acquired .

    • Apply lateral gene transfer analysis frameworks to understand the acquisition and evolution of both Lgt and pollutant degradation pathways.

  • Comparative Studies Across Environmental Isolates:

    • Extend comparative genomic hybridization studies to specifically examine Lgt variation among the highly conserved plasmid (99% identical) found in PM1-like MTBE-degrading isolates from different geographical locations.

    • Correlate Lgt sequence variations with differences in substrate utilization profiles or environmental adaptations.

This research agenda would not only advance our fundamental understanding of bacterial adaptation mechanisms but could also lead to practical applications in environmental biotechnology and bioremediation system design.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.