Recombinant Methylibium petroleiphilum Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Definition and Origin

Recombinant Methylibium petroleiphilum Protease HtpX homolog is a zinc-dependent metalloprotease expressed heterologously in systems like Escherichia coli or Bacillus subtilis . The native htpX gene (locus tag: Mpe_A0285) encodes a 283-amino-acid protein (UniProt ID: A2SCF8) involved in proteolytic quality control, particularly under stress conditions . Its recombinant form retains catalytic activity and stability for industrial and research applications.

Expression and Purification

Recombinant HtpX is typically produced using plasmid vectors (e.g., pHT43 or pET systems) in E. coli BL21(DE3) or B. subtilis WB800N . Purification involves:

  1. Solubilization: Octyl-β-D-glucoside extraction from membranes .

  2. Chromatography: Sequential cobalt-affinity, anion-exchange, and size-exclusion steps .

  3. Yield: Milligram quantities with >90% purity, stabilized in Tris buffer with 50% glycerol .

Biochemical Properties

Studies reveal the following enzymatic traits:

  • Optimal pH: Neutral (pH 6.5–7.5) .

  • Thermal stability: Retains activity up to 50°C .

  • Substrate specificity: Degrades casein and membrane proteins (e.g., SecY) .

Table 2: Enzymatic Activity Parameters

ParameterValueSource
Temperature Optimum30–37°C
InhibitorsEDTA (Zn²⁺ chelation)
Kinetic Activity (Casein)Vmax=0.8μmol/min/mgV_{max} = 0.8 \, \mu mol/min/mg

Functional Roles

  • Protein quality control: Cleaves misfolded membrane proteins, preventing cytotoxicity .

  • Stress response: Upregulated under ethanol or hydrocarbon exposure in M. petroleiphilum .

  • Bioremediation: Indirectly supports hydrocarbon degradation by maintaining cellular protein homeostasis .

Applications

  1. Biotechnological tool: Used in ELISA kits and protein interaction studies (Creative BioMart, ).

  2. Industrial biocatalysis: Potential in detergent formulations due to thermal stability .

  3. Research: Serves as a model for studying membrane protease mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include your desired format in your order notes for our preparation.
Lead Time
Delivery time may vary based on your purchase method and location. For specific delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for your request.
Synonyms
htpX; Mpe_A0285; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Target Names
htpX
Target Protein Sequence
MFNLMKTAVLMAAITALFMAIGSVLGGQQGMAIALVVALGMNFFSYWFSDKMVLKMYNAQ EVDASSAPQFYGMVRELAAKAELPMPKVYLINEDAPNAFATGRNPQNAAVAATTGILRVL SERELRGVMAHELAHVKHRDILISTISATMAGAISMLANFAMFFGGRGSDGRPANPIAGI LVMLLAPLAASLIQMAISRAREFEADRGGAEISGDPQALASALQKIQRYAQGIPLEAAER HPETAQMMIMNPLSGGGLRGLFSTHPATEERVAKLMAMVPQRV
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Methylibium petroleiphilum Protease HtpX?

Methylibium petroleiphilum Protease HtpX homolog is a membrane-bound metallopeptidase that belongs to the M48 family of zinc metalloproteinases. This protease plays a fundamental role in protein quality control mechanisms by preventing the accumulation of misfolded proteins in the bacterial membrane, similar to its well-studied homolog in Escherichia coli . The HtpX protein is characterized by its multiple hydrophobic regions that likely serve as transmembrane segments, although the exact membrane topology remains somewhat controversial regarding whether the C-terminal regions are embedded in the membrane . Within the M. petroleiphilum PM1 genome, the htpX gene is part of a complex genomic landscape that has been entirely sequenced, revealing its genetic context and potential regulatory elements . The protease functions as part of the cell's quality control machinery, with evidence from E. coli homologs suggesting it is involved in the degradation of aberrant membrane proteins, thereby maintaining membrane integrity and cellular function .

What is the genomic context of htpX in M. petroleiphilum?

The htpX gene in Methylibium petroleiphilum is located within the fully sequenced genome of strain PM1, which consists of a circular chromosome of 4,044,225 bp and a megaplasmid (pPM1) of 599,444 bp . Genomic analysis reveals that the PM1 genome carries 4,477 putative coding sequences (CDSs), with 964 being unique to PM1 based on BLASTP searches against nonredundant databases . The genomic neighborhood of htpX can provide insights into potential co-regulated genes or functional operons, although specific details about adjacent genes were not explicitly mentioned in the search results. Comparative genomic hybridization experiments between PM1 and PM1-like MTBE-degrading isolates (with approximately 99% identical 16S rRNA gene sequences) demonstrated significant chromosomal diversity despite plasmid conservation . When examining the distribution of best BLASTP hits among major phylogenetic groups for PM1 genes, it was observed that the closest homologs were most often found in other beta-proteobacterial genomes (2,332 hits), particularly in Ralstonia solanacearum (790 hits) and Burkholderia pseudomallei (497 hits) . Understanding this genomic context is essential for interpreting the evolutionary history and potential horizontal gene transfer events that shaped the current form of the htpX gene in M. petroleiphilum.

How is htpX regulated in bacterial systems?

Based on studies of the E. coli homolog, htpX expression is primarily regulated as part of the heat shock response pathway. The gene is expressed from a sigma 32-dependent promoter, making it an integral component of the heat shock regulon . This regulatory mechanism ensures that htpX expression is induced during temperature upshift, which typically correlates with increased protein misfolding events in the cell . The htpX gene in E. coli has been localized to minute 40.3 on the chromosome and expresses a 32-kDa protein from a monocistronic transcript . While specific data on the regulation of the M. petroleiphilum htpX homolog is not explicitly detailed in the search results, it is reasonable to hypothesize similar heat-responsive regulation given the conserved function of this protease across bacterial species. In bacterial systems generally, proteases involved in quality control are often subject to complex regulatory networks that integrate various cellular stress signals beyond heat, including oxidative stress, envelope stress, and nutrient limitation . Transcriptional regulation may be complemented by post-translational regulatory mechanisms that modulate protease activity according to the cell's immediate needs, potentially involving cofactors, inhibitors, or substrate availability that collectively fine-tune the proteolytic response to cellular conditions.

What are the challenges in expressing recombinant HtpX?

The expression of recombinant proteases like HtpX presents several significant challenges that must be addressed through careful experimental design. First and foremost, the catalytic function of proteases often causes toxicity in E. coli heterologous hosts, leading to growth inhibition or cell death when overexpressed . This toxicity arises because proteases can indiscriminately degrade host proteins essential for cellular viability. Additionally, HtpX is an integral membrane protein with multiple transmembrane domains, which introduces complications related to proper folding, membrane insertion, and potential aggregation during overexpression . The hydrophobic nature of these transmembrane segments makes the protein prone to misfolding and formation of inclusion bodies when expression levels exceed the capacity of the cell's membrane protein insertion machinery. Furthermore, maintaining the native conformation of HtpX requires appropriate metal ion (zinc) coordination, and expression conditions must support proper metalloprotein assembly . Another challenge involves developing suitable extraction and purification protocols that maintain the structural integrity and activity of the membrane-bound protease while removing it from its lipid environment . Researchers must also contend with potential autoproteolysis during expression and purification, which can significantly reduce yield and complicate biochemical analysis.

Which expression systems are most effective for recombinant HtpX production?

For effective recombinant HtpX production, E. coli BL21(DE3) pLysS has proven successful as an expression host that enables tight control of recombinant protein expression, which is particularly important for potentially toxic proteases . This strain contains the pLysS plasmid that produces T7 lysozyme, which binds to and inhibits T7 RNA polymerase, thereby reducing basal expression levels and minimizing toxicity before induction . The choice of expression vector is equally crucial, with pET-derived vectors showing effectiveness for HtpX expression when configured with appropriate tags such as a C-terminal His8-tag for purification purposes . For challenging membrane proteins like HtpX, utilizing vectors that allow fusion with solubility-enhancing domains has demonstrated significant improvements in expression outcomes . Specifically, vectors encoding fusion proteins such as maltose-binding protein (MBP), SP-MBP (containing a signal peptide at the N-terminus of MBP), disulfide oxidoreductase (DsbA), and Glutathione S-transferase (GST) have enhanced both expression levels and solubility of proteases including HtpX homologs . Temperature optimization is another critical factor, with lower induction temperatures (typically 16-25°C) often yielding better results for membrane protein expression by slowing down the production rate and allowing more time for proper folding and membrane insertion. Additionally, incorporating glucose in the growth medium helps in shutting off transcription of the T7 RNA polymerase gene under the control of the lac UV5 promoter, further tightening expression control .

How can solubility of recombinant HtpX be improved?

Improving the solubility of recombinant HtpX requires a multi-faceted approach addressing both expression conditions and protein engineering strategies. One established method involves the use of fusion protein tags that enhance solubility, with maltose-binding protein (MBP), Glutathione S-transferase (GST), and disulfide oxidoreductase (DsbA) demonstrating particular effectiveness in increasing protease solubility . Two variants of MBP fusion have been developed: pMBP, which lacks a signal peptide but contains a His-tag upstream of MBP, and pSP-MBP, which includes a signal peptide at the N-terminal end of MBP and positions the His-tag at the C-terminal end . The addition of a signal peptide in constructs like pSP-MBP or pDsbA can direct the recombinant protein to the periplasmic space, potentially improving folding in this more oxidizing environment . Optimizing growth conditions represents another crucial approach, with induction at lower temperatures (16-20°C) slowing down protein synthesis and allowing more time for proper folding and membrane insertion. The choice of detergent for membrane protein extraction significantly impacts solubility, with octyl-β-d-glucoside proving effective for HtpX extraction from E. coli membranes . Co-expression with molecular chaperones like GroEL/GroES or DnaK/DnaJ/GrpE can assist proper folding and prevent aggregation. Additionally, using E. coli strains engineered for membrane protein expression, such as C41(DE3) or C43(DE3), may improve outcomes compared to standard BL21(DE3) strains for challenging membrane proteins like HtpX.

What are the established methods for measuring HtpX protease activity?

Several complementary methods have been established for measuring HtpX protease activity, each offering different advantages for functional characterization. One approach involves an in vivo protease activity assay system developed specifically for investigating E. coli HtpX, which utilizes a model substrate (XMS1) that allows for semiquantitative and convenient detection of protease activity . This system enables the detection of differential protease activities of HtpX mutants carrying mutations in conserved regions, providing insights into structure-function relationships . Zymography represents another valuable technique for detecting proteolytic activity, where samples are separated by non-reducing SDS-PAGE in gels containing substrates like gelatin, and zones of proteolysis appear as clear bands against a stained background after incubation . Fluorescence-based assays offer high sensitivity for detecting proteolytic activity, with substrates such as Rhodamine 110-based serine protease substrate (BZAR) or DQ-substrates that increase in fluorescence upon proteolytic cleavage . For these assays, specific criteria like slope thresholds and signal-to-noise ratios (typically using thresholds of 0.015 and 2, respectively) are employed to confirm protease activity . For the specific study of membrane proteases like HtpX, assays monitoring the degradation of puromycyl peptides have also been developed, as overexpression of a truncated form of HtpX in E. coli displayed a higher rate of degradation of these aberrant peptides .

How does the structure of HtpX relate to its function?

The structure of HtpX is intricately linked to its function as a membrane metalloprotease involved in protein quality control. HtpX contains four hydrophobic regions (H1-H4) that likely function as transmembrane segments, although there is some controversy regarding whether the two C-terminal regions are truly embedded in the membrane . As a member of the M48 family of zinc metalloproteinases, HtpX contains a conserved HEXXH motif in its catalytic domain, where the two histidine residues coordinate a zinc ion essential for catalytic activity and the glutamate functions as a catalytic base during peptide bond hydrolysis . This metal-coordinating structure explains the classification of HtpX as a metallopeptidase and its sensitivity to metal chelators. The membrane-embedded nature of HtpX positions it ideally for accessing and degrading misfolded membrane proteins, allowing it to recognize exposed degradation signals that would normally be buried in properly folded proteins . Structural studies have been facilitated by successfully overexpressing and purifying catalytically ablated forms of HtpX, extracted from membranes using octyl-β-d-glucoside and purified to homogeneity through a three-step process involving cobalt-affinity, anion-exchange, and size-exclusion chromatography . The production of HtpX in milligram amounts has paved the way for detailed structural studies that will be essential for understanding the catalytic mechanism of this membrane peptidase and related family members .

What are the known substrates of HtpX in different bacterial systems?

The identification of physiological substrates for HtpX has been challenging, limiting our comprehensive understanding of its exact roles in different bacterial systems. In E. coli, where HtpX has been most extensively studied, the protease is believed to target misfolded or damaged membrane proteins, though specific natural substrates have not been fully cataloged . Experimental evidence indicates that cells overexpressing a truncated form of HtpX display a higher rate of degradation of puromycyl peptides, suggesting these aberrant polypeptides may be among its targets . For functional studies, researchers have developed model substrates to characterize HtpX activity, such as the HtpX model substrate 1 (XMS1) used in an in vivo assay system for E. coli HtpX . This artificial substrate allows for the detection of proteolytic cleavage events, yielding full-length (XMS1-FL) and cleaved fragments (CL-C and CL-N) that can be monitored to assess protease activity . In Methylibium petroleiphilum specifically, the natural substrates of the HtpX homolog have not been explicitly identified in the available search results. Substrate specificity studies across bacterial systems suggest that while HtpX likely targets misfolded membrane proteins broadly, there may be species-specific variations in preference or regulation that reflect the different membrane protein compositions and stress response mechanisms in diverse bacteria .

How can site-directed mutagenesis be used to study HtpX function?

Site-directed mutagenesis represents a powerful approach for elucidating the structure-function relationships of HtpX by enabling targeted modification of specific amino acid residues. This technique is particularly valuable for investigating the catalytic mechanism of HtpX as a metalloprotease by systematically mutating conserved residues in the HEXXH motif, which coordinates the catalytic zinc ion essential for proteolytic activity . By replacing the histidine or glutamate residues in this motif with alanine or other amino acids, researchers can create catalytically ablated forms of HtpX that are useful both for structural studies and for understanding the contribution of each residue to the catalytic process . The in vivo protease activity assay system developed for E. coli HtpX has proven particularly useful for analyzing such mutations, as it enables detection of differential protease activities of HtpX mutants carrying mutations in conserved regions . Beyond the catalytic site, mutagenesis of the transmembrane segments can provide insights into the importance of specific membrane topology for substrate recognition and enzyme function, helping to resolve controversies regarding whether certain hydrophobic regions are truly embedded in the membrane . Additional targets for site-directed mutagenesis include potential substrate-binding sites, regulatory domains, or residues involved in protease dimerization or interaction with other proteins in the quality control machinery. Combining mutagenesis with structural studies and activity assays creates a comprehensive approach to dissecting the molecular determinants of HtpX function and specificity.

What comparative genomic approaches reveal about HtpX conservation and evolution?

Comparative genomic approaches have provided valuable insights into the conservation and evolution of HtpX across bacterial species. Whole-genome analysis of Methylibium petroleiphilum PM1 revealed that among its 4,477 putative coding sequences, 964 are unique to PM1 based on BLASTP searches against nonredundant databases . When examining the distribution of best BLASTP hits for PM1 genes, the closest homologs were most frequently found in other beta-proteobacterial genomes (2,332 hits), particularly in Ralstonia solanacearum (790 hits) and Burkholderia pseudomallei (497 hits), suggesting evolutionary relationships between these species . Comparative genomic hybridization experiments between PM1 and two PM1-like MTBE-degrading environmental isolates (with approximately 99% identical 16S rRNA gene sequences) demonstrated significant chromosomal diversity despite high conservation of the plasmid, indicating different evolutionary trajectories for chromosomal versus plasmid-encoded genes . For studying HtpX specifically, phylogenetic tree analysis based on homologs identified through BLASTP searches against the nonredundant GenBank database can elucidate evolutionary relationships between different species' variants . Multiple sequence alignments of HtpX homologs reveal highly conserved regions, particularly around the catalytic HEXXH motif characteristic of M48 family zinc metalloproteinases, highlighting functionally critical domains maintained throughout evolution . The conservation pattern of HtpX across diverse bacterial species suggests its fundamental importance in bacterial physiology, particularly in membrane protein quality control mechanisms that are essential for cellular homeostasis across the bacterial kingdom.

How does HtpX interact with other components of protein quality control systems?

The interaction of HtpX with other components of protein quality control systems represents a complex network of coordinated activities ensuring membrane protein homeostasis. In E. coli, HtpX is believed to work in concert with other proteases, particularly FtsH, another membrane-bound protease involved in quality control . Studies suggest that HtpX may serve as a complementary or backup proteolytic system when the primary quality control mechanisms are overwhelmed or compromised . Evidence indicates that HtpX is part of the heat shock regulon, expressed from a sigma 32-dependent promoter, which places it within a broader stress response network activated under conditions that promote protein misfolding . This regulatory connection suggests coordination with cytoplasmic chaperones like GroEL/GroES and DnaK/DnaJ/GrpE, which assist in protein folding during stress conditions. The membrane localization of HtpX positions it strategically to interact with membrane protein insertion machinery, potentially allowing it to detect and eliminate proteins that fail to insert properly into the membrane . While specific protein-protein interactions involving M. petroleiphilum HtpX have not been extensively characterized in the search results, studies of related systems suggest potential interactions with components that recognize, unfold, and present substrates to the protease active site. Understanding these interactions requires techniques such as co-immunoprecipitation, bacterial two-hybrid systems, or proximity labeling approaches coupled with mass spectrometry to identify interaction partners within the complex environment of the bacterial membrane.

How to address inconsistent activity measurements with recombinant HtpX?

Addressing inconsistent activity measurements with recombinant HtpX requires a systematic investigation of multiple factors that influence protease function. First, ensure proper metal ion incorporation by supplementing reaction buffers with appropriate concentrations of zinc (or other divalent metal ions) and avoiding metal chelators like EDTA in any buffers used during purification or activity assays . Consider the detergent environment carefully, as the activity of membrane proteases is highly dependent on the lipid/detergent micelle composition; octyl-β-d-glucoside has been successfully used for HtpX extraction and purification, but systematic testing of different detergents and concentrations may be necessary to optimize activity . When using fluorescence-based assays, establish clear criteria for confirming protease activity, such as slope thresholds and signal-to-noise ratios (with typical thresholds being 0.015 and 2, respectively) . To distinguish true enzymatic activity from potential contaminating proteases, always include appropriate controls such as heat-inactivated enzyme, catalytically inactive mutants (e.g., mutations in the HEXXH motif), and protease inhibitor controls . Standardize assay conditions including temperature, pH, ionic strength, and substrate concentration, as these parameters significantly affect enzymatic activity measurements. For in vivo activity assays, consider the expression level of the protease, as overexpression might lead to artificial substrate processing or cellular toxicity that complicates interpretation . Finally, ensure the structural integrity of the recombinant protein by analytical techniques such as circular dichroism or limited proteolysis, as improper folding due to expression or purification conditions can dramatically affect measured activity.

What strategies can overcome low yield in HtpX purification?

Overcoming low yield challenges in HtpX purification requires implementation of multiple complementary strategies targeting expression, extraction, and purification steps. To enhance expression levels, optimize codon usage in the expression construct by either using codon-optimized synthetic genes or expressing in E. coli strains supplemented with rare tRNAs . Consider using fusion tags known to enhance expression and solubility, with MBP, SP-MBP, DsbA, and GST demonstrating particular effectiveness for challenging proteases . Fine-tune induction conditions by testing different IPTG concentrations, induction temperatures (typically 16-25°C), and induction durations to identify parameters that maximize protein yield while minimizing toxicity and inclusion body formation. For membrane protein extraction, systematic testing of different detergents beyond the successfully used octyl-β-d-glucoside may identify alternatives that provide better extraction efficiency while maintaining protein stability . Implement a multi-step purification strategy as demonstrated for HtpX purification, involving cobalt-affinity chromatography followed by anion-exchange and size-exclusion chromatography to achieve high purity while maximizing recovery at each step . Consider expressing catalytically inactive variants of HtpX by mutating the catalytic HEXXH motif, as these may be less toxic to the expression host and less prone to autoproteolysis during purification . Add appropriate protease inhibitors during cell lysis and early purification steps to prevent degradation by host proteases, while ensuring these inhibitors don't chelate the zinc ion essential for HtpX structural integrity. Finally, optimize buffer conditions throughout the purification process, particularly regarding salt concentration, pH, glycerol content, and reducing agent concentration, to maintain protein stability and prevent aggregation or precipitation.

How to differentiate between direct and indirect effects in HtpX knockout studies?

Differentiating between direct and indirect effects in HtpX knockout studies presents a significant challenge that requires multiple complementary approaches for reliable interpretation. First, perform targeted complementation experiments where the wild-type htpX gene is reintroduced into the knockout strain under control of an inducible promoter; phenotypes directly caused by HtpX absence should be fully rescued upon complementation . To distinguish between enzymatic and structural roles of HtpX, complement the knockout with catalytically inactive point mutants (e.g., mutations in the HEXXH motif); phenotypes requiring the proteolytic activity should not be rescued by these mutants, while phenotypes dependent merely on HtpX's physical presence might be . Conduct time-course experiments to establish the temporal relationship between HtpX deletion and observed phenotypes; direct effects typically manifest more rapidly than indirect consequences that require multiple steps of dysregulation. Implement proteomic approaches comparing wild-type, knockout, and complemented strains to identify proteins with altered abundance, potentially revealing direct substrates (increased in knockout) or downstream effectors . Use in vivo crosslinking or proximity labeling techniques to identify proteins that physically interact with HtpX, as these are more likely to be directly affected by its absence. Construct double knockouts targeting HtpX and other components of the protein quality control system (e.g., FtsH) to assess potential redundancy or synergy; synthetic phenotypes may reveal compensatory mechanisms that mask direct effects in single knockouts . Finally, develop substrate trapping approaches using catalytically inactive HtpX variants that can bind but not cleave substrates, allowing isolation and identification of direct targets through affinity purification coupled with mass spectrometry.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.