Recombinant Methylibium petroleiphilum Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. Please specify your required tag type for prioritized development.
Synonyms
uppP; Mpe_A1046; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Target Names
uppP
Target Protein Sequence
MDILLLVKAAIMGIVEGLTEFLPISSTGHLILTASLLNFTGEIVKVFDIAIQTGAMFAVI WEYRVRLRATVAGITHEAVAQRFVRNLLIAFVPAVISGLALGGLIKEHLFHPVPVATAFV VGGLIILWVERRHRALFGDRDLEGGRVARVETIDDMSALDALKVGLVQCAALIPGTSRSG ATIIGAMLFGFSRKAATEFSFFLGIPTLMGAGAYSLIKQRDLLSWGDLPVFAVGVVFAFL SALVCIRWLIRYVSTHDFTVFAWYRIAFGGLVLLSAWGGWVDWKD
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Methylibium petroleiphilum Undecaprenyl-diphosphatase (uppP) and what is its biological function?

Methylibium petroleiphilum Undecaprenyl-diphosphatase (uppP), also known as Bacitracin resistance protein or Undecaprenyl pyrophosphate phosphatase (EC 3.6.1.27), is an integral membrane protein essential for bacterial cell wall synthesis. This enzyme catalyzes the critical dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, which serves as an essential carrier lipid in bacterial cell wall synthesis pathways . The reaction is fundamental to peptidoglycan biosynthesis, as undecaprenyl phosphate functions as a lipid carrier that transports peptidoglycan precursors across the cytoplasmic membrane to support cell wall assembly . This enzymatic function positions uppP as a potential target for antibacterial agents, given its essential role in maintaining bacterial cell wall integrity and structure.

How is the recombinant M. petroleiphilum uppP protein typically expressed and purified for research purposes?

Recombinant M. petroleiphilum uppP can be expressed using established bacterial expression systems. One effective approach involves using specialized E. coli strains such as C41(DE3), which are optimized for membrane protein expression . The expression vector containing the uppP gene is transformed into these cells, which are then grown in LB medium supplemented with appropriate antibiotics (typically ampicillin at 100 mg/ml). When bacterial culture density reaches approximately A600 of 0.9, expression is induced with isopropyl β-d-thiogalactoside (IPTG) at a final concentration of 0.5 mM . For certain fusion protein constructs, additives such as all-trans-retinal may be necessary during induction.

For purification, cells are harvested and disrupted using mechanical methods such as constant cell disruption systems. The membrane fraction containing the uppP protein is isolated through ultracentrifugation at approximately 40,000 rpm for 1.5 hours . The membrane proteins are then solubilized using appropriate detergents, commonly n-dodecyl-β-D-maltoside (DDM), followed by affinity chromatography that leverages any incorporated tags in the recombinant construct. The purified protein is typically stored in a buffer containing Tris, glycerol, and minimal detergent concentrations to maintain stability . For extended storage, the protein should be kept at -20°C or -80°C, avoiding repeated freeze-thaw cycles .

What are the conserved motifs in uppP proteins, and how do they relate to enzymatic function?

Sequence alignment analyses reveal two highly conserved consensus regions in bacterial uppP enzymes that are essential for catalytic activity. The first region contains a glutamate-rich motif denoted as (E/Q)XXXE, while the second contains the characteristic PGXSRSXXT sequence . These conserved sequences, together with a critical histidine residue, constitute the primary components of the enzyme's active site. Topological models predict that both of these motifs are strategically positioned near the aqueous interface of the membrane protein and face the periplasmic space, suggesting that the enzyme's catalytic function occurs on the outer side of the plasma membrane .

Mutagenesis studies have demonstrated that specific residues within these motifs are absolutely critical for enzymatic function. Mutations such as E17A/E21A, H30A, S173A, R174A, and T178A completely abolish enzyme activity, confirming that these conserved regions form the catalytic center of uppP . Additionally, uppP demonstrates an absolute requirement for divalent metal ions, specifically magnesium or calcium, for enzymatic activity. This dependence on metal cofactors suggests that these ions may participate in the coordination and positioning of the pyrophosphate substrate or play a role in the catalytic mechanism itself .

What are the optimal storage conditions for maintaining the stability and activity of recombinant uppP preparations?

For optimal preservation of recombinant M. petroleiphilum uppP activity and structural integrity, specific storage protocols must be followed. The purified protein should be maintained in a specialized buffer system, typically composed of a Tris-based buffer supplemented with 50% glycerol and optimized specifically for this membrane protein . This high glycerol concentration prevents ice crystal formation during freezing, protecting the protein's tertiary structure and functional domains.

For short-term storage (up to one week), working aliquots can be kept at 4°C to minimize freeze-thaw damage while maintaining accessibility for ongoing experiments . For extended storage periods, the protein should be stored at either -20°C or preferably at -80°C for maximum stability . It is crucial to avoid repeated freezing and thawing cycles, as these can lead to protein denaturation, aggregation, and subsequent loss of enzymatic activity. This is particularly important for membrane proteins like uppP, which are inherently less stable once removed from their native lipid environment. When preparing samples for long-term storage, dividing the purified protein into single-use aliquots is recommended to eliminate the need for multiple freeze-thaw cycles of the same sample.

How can three-dimensional structural modeling and molecular dynamics simulations enhance our understanding of uppP's catalytic mechanism?

Advanced computational approaches have proven invaluable for elucidating the structure-function relationships of uppP in the absence of complete crystal structures. Three-dimensional modeling using methods such as Rosetta membrane ab initio approaches allows researchers to predict the tertiary structure of uppP within the membrane environment . These models can be further refined through molecular dynamics simulations that account for the protein's behavior in lipid bilayers, incorporating the complex interactions between the enzyme, substrate, and membrane components.

Such computational approaches have revealed critical insights about the catalytic site architecture of uppP, demonstrating how the conserved (E/Q)XXXE and PGXSRSXXT motifs interact with the undecaprenyl pyrophosphate substrate . Molecular dynamics simulations further enhance these models by demonstrating the dynamic nature of these interactions, revealing how conformational changes may facilitate substrate binding, catalysis, and product release. The simulations can also elucidate the roles of divalent cations (Mg²⁺ or Ca²⁺) in the reaction mechanism, showing how these ions may coordinate with the pyrophosphate moiety and catalytic residues to promote dephosphorylation .

By integrating computational predictions with experimental mutagenesis data, researchers can formulate detailed mechanistic hypotheses about uppP function that would be difficult to obtain through experimental approaches alone. This integrated approach provides a molecular-level understanding of enzyme-substrate interactions in membrane bilayers, offering valuable insights for the design of specific inhibitors targeting this essential bacterial enzyme.

What biochemical assays can be used to accurately measure uppP enzymatic activity, and what are the critical parameters to consider?

Several robust biochemical assays can be employed to measure uppP activity, with phosphate release detection methods being particularly effective. A standard approach utilizes the Malachite Green assay, which quantifies inorganic phosphate released during the dephosphorylation reaction through a colorimetric readout measured at 650 nm . The reaction is typically conducted in a buffer containing 50 mM Hepes (pH 7.0), 150 mM NaCl, 10 mM MgCl₂, and 0.02% DDM detergent to maintain protein solubility .

For kinetic analyses, farnesyl pyrophosphate (Fpp) often serves as a substrate analog, with concentrations ranging from 0.3–57 μM depending on the experimental objective . The enzyme concentration should be carefully optimized, typically between 20-40 nM, to ensure linear reaction rates during initial velocity measurements . Reactions are generally performed at 37°C and quenched by adding Malachite Green reagent at predetermined time points.

Critical parameters that must be controlled include:

  • pH optimization: Activity should be assessed across a range of pH values (5-9) using appropriate buffers such as sodium acetate (pH 5-6), Hepes (pH 6.5-8), and Tris-HCl (pH 9)

  • Divalent cation requirements: Magnesium or calcium ions are essential cofactors, typically added at 10 mM concentrations

  • Detergent concentration: Must be sufficient to maintain protein solubility without inhibiting activity

  • Substrate specificity: Comparing native substrates with analogs to determine enzyme selectivity

  • Temperature dependence: Assessing activity across relevant temperature ranges

For detailed kinetic characterization, initial velocity data should be fitted to the Michaelis-Menten equation to determine key parameters such as Km and kcat values . This information provides insights into substrate affinity and catalytic efficiency, which are essential for understanding enzyme function and evaluating potential inhibitors.

How can site-directed mutagenesis be effectively designed and implemented to investigate structure-function relationships in M. petroleiphilum uppP?

Site-directed mutagenesis represents a powerful approach for probing the functional importance of specific amino acid residues in M. petroleiphilum uppP. Based on sequence conservation analysis and structural predictions, a strategic mutagenesis program should initially target the conserved motifs: (E/Q)XXXE, PGXSRSXXT, and the critical histidine residue . The experimental design should incorporate the following methodological considerations:

  • Target selection strategy: Prioritize residues based on conservation analysis across bacterial species, predicted proximity to the active site from computational models, and chemical properties relevant to catalysis (e.g., charged residues for substrate binding, nucleophilic residues for catalysis) .

  • Mutation design principles: Consider conservative substitutions (maintaining similar physiochemical properties) versus non-conservative substitutions (dramatic changes in properties). For example, replacing glutamate with alanine (E→A) eliminates the negative charge and hydrogen bonding capabilities, while glutamate to aspartate (E→D) preserves charge but alters side chain length .

  • Expression system optimization: Express the mutant proteins using specialized expression systems for membrane proteins, such as bacteriorhodopsin-fusion constructs, which have proven successful for wild-type uppP expression and purification .

  • Comparative activity assessment: Evaluate the kinetic parameters (Km, kcat, kcat/Km) of purified mutant enzymes against the wild-type enzyme under standardized conditions. A systematic comparison of these parameters can reveal the contribution of specific residues to substrate binding versus catalytic turnover .

  • Structural integrity verification: Confirm that activity changes result from specific catalytic effects rather than global structural perturbations through techniques such as circular dichroism, limited proteolysis, or thermal stability assays.

The mutagenesis analysis should be designed as a comprehensive matrix experiment, where multiple mutations are systematically created and characterized to build a complete functional map of the enzyme. Previous studies have demonstrated that mutations such as E17A/E21A, H30A, S173A, R174A, and T178A completely abolish enzymatic activity, confirming their critical roles in catalysis . This systematic approach can establish a detailed structure-function relationship map for M. petroleiphilum uppP, providing insights into its catalytic mechanism and evolutionary relationships with other phosphatases.

What is the relationship between uppP and bacterial antibiotic resistance, particularly against bacitracin?

Undecaprenyl pyrophosphate phosphatases, including M. petroleiphilum uppP, play a significant role in bacterial antibiotic resistance, particularly against bacitracin, as evidenced by one of uppP's alternative names: "Bacitracin resistance protein" . This relationship stems from the mechanism of action of bacitracin, which binds to undecaprenyl pyrophosphate (UPP), preventing its dephosphorylation to undecaprenyl phosphate (UP) . Since UP is essential for peptidoglycan precursor transport across the cytoplasmic membrane during cell wall synthesis, this inhibition disrupts bacterial cell wall formation, leading to cell death.

UppP confers resistance to bacitracin through several potential mechanisms:

  • Increased dephosphorylation activity: Elevated expression or enhanced catalytic efficiency of uppP increases the conversion rate of UPP to UP, effectively competing with bacitracin for the UPP substrate .

  • Altered substrate binding site: Structural variations in uppP may reduce bacitracin's ability to interfere with the dephosphorylation reaction, allowing continued cell wall synthesis even in the presence of the antibiotic .

  • Metabolic bypass: UppP activity may provide alternative pathways for regenerating the essential lipid carrier, circumventing the bacitracin-inhibited steps in the cell wall synthesis pathway.

Research methodologies for investigating this relationship include:

  • Growth inhibition assays: Comparing bacitracin minimum inhibitory concentrations (MICs) between wild-type bacteria and strains with modified uppP expression levels.

  • Enzyme inhibition studies: Examining whether bacitracin directly inhibits uppP activity in vitro using phosphate release assays.

  • Resistance development monitoring: Tracking changes in uppP sequence, structure, or expression levels in bacterial populations exposed to increasing bacitracin concentrations over multiple generations.

Understanding this relationship is critical for developing new antibacterial strategies that target cell wall synthesis pathways, potentially restoring sensitivity to existing antibiotics in resistant bacterial strains .

What comparative analyses can be performed between M. petroleiphilum uppP and homologous enzymes from other bacterial species?

Comprehensive comparative analyses between M. petroleiphilum uppP and homologous enzymes from diverse bacterial species can yield valuable insights into evolutionary relationships, functional conservation, and species-specific adaptations. These analyses should incorporate multiple complementary approaches:

Bacterial SpeciesSubstrateKm (μM)kcat (s⁻¹)kcat/Km (M⁻¹s⁻¹)pH OptimumMetal Requirement
M. petroleiphilumFPP----Mg²⁺/Ca²⁺
E. coliFPP21.512.35.7 × 10⁵7.0Mg²⁺
S. aureusFPP-----
  • Inhibitor sensitivity profiling: Comparing the response of uppP homologs to various inhibitors, including antibiotics like bacitracin, can reveal species-specific differences in binding site structures and potential resistance mechanisms .

  • Expression pattern analysis: Investigating how uppP expression is regulated in different bacterial species in response to environmental stressors, particularly cell wall-targeting antibiotics, can provide insights into the enzyme's role in adaptive responses.

This multi-faceted comparative approach would not only enhance our fundamental understanding of uppP evolution and function but could also identify species-specific features that might be exploited for the development of narrow-spectrum antibacterial agents targeting specific bacterial pathogens while sparing beneficial microbiota.

What are the optimal conditions for assaying M. petroleiphilum uppP enzymatic activity in vitro?

The successful measurement of M. petroleiphilum uppP activity requires careful optimization of multiple experimental parameters. Based on established protocols for related undecaprenyl pyrophosphate phosphatases, the following conditions represent a methodologically sound starting point for enzyme activity assays:

Buffer composition: 50 mM Hepes at pH 7.0, 150 mM NaCl, 10 mM MgCl₂, and 0.02% DDM (n-dodecyl-β-D-maltoside) detergent . This buffer system provides physiologically relevant pH conditions while maintaining protein solubility and stability. The pH optimum should be experimentally confirmed by testing activity across a range from pH 5-9 using appropriate buffer systems: sodium acetate (pH 5-6), Hepes (pH 6.5-8), and Tris-HCl (pH 9) .

Divalent cation requirements: Magnesium or calcium ions are essential cofactors for uppP activity, typically added at 10 mM concentrations . Enzyme activity should be tested with various divalent cations (Mg²⁺, Ca²⁺, Mn²⁺, Zn²⁺) to determine specificity and optimal concentration.

Substrate selection: While the natural substrate is undecaprenyl pyrophosphate, farnesyl pyrophosphate (Fpp) often serves as a more accessible substrate analog for in vitro studies . For kinetic analyses, substrate concentrations typically range from 0.3–57 μM, with enzyme concentrations between 20-40 nM to ensure linear reaction rates during initial velocity measurements .

Reaction conditions: Standard assays are conducted at 37°C, with reactions initiated by enzyme addition and quenched at appropriate time points by adding 30 μl of Malachite Green reagent to detect released phosphate . Absorbance is measured at 650 nm and quantified using a phosphate standard curve.

How can researchers effectively overcome challenges in expressing and purifying functional recombinant M. petroleiphilum uppP?

Expressing and purifying functional integral membrane proteins like M. petroleiphilum uppP presents significant challenges that require specialized approaches. Researchers can implement the following methodological strategies to enhance success:

By systematically addressing these challenges with the described methodological approaches, researchers can significantly improve the yield and quality of functional recombinant M. petroleiphilum uppP for subsequent structural and functional studies.

How might structural insights from uppP research contribute to the development of new antibacterial agents?

The structural and functional characterization of M. petroleiphilum uppP provides valuable opportunities for rational antibiotic design targeting bacterial cell wall synthesis. Given that undecaprenyl pyrophosphate phosphatases are essential for bacterial survival and lack human homologs, they represent attractive targets for selective antibacterial therapy . Several strategic research directions can exploit these insights:

  • Structure-based inhibitor design: Using the three-dimensional models of uppP derived from computational approaches and validated through mutagenesis studies, researchers can identify potential binding pockets within the enzyme's active site . Virtual screening of compound libraries against these models can identify candidate molecules that might interfere with substrate binding or catalysis. This approach has proven successful with the related enzyme undecaprenyl diphosphate synthase (UPPS), where crystal structures guided the identification of novel inhibitors .

  • Allosteric inhibition strategies: Beyond the catalytic site, the identification of allosteric sites that influence enzyme function when occupied by small molecules offers additional targeting opportunities. Molecular dynamics simulations can reveal conformational changes in uppP that might expose druggable allosteric sites .

  • Combination therapy approaches: Understanding how uppP contributes to antibiotic resistance, particularly against bacitracin and potentially other cell wall-targeting antibiotics, can inform combination therapies that simultaneously target multiple steps in bacterial cell wall synthesis . For example, agents that inhibit uppP could potentially restore sensitivity to bacitracin in resistant strains.

  • Species-selective targeting: Comparative analyses of uppP structures from different bacterial species can highlight structural differences that might be exploited to develop narrow-spectrum antibiotics targeting specific pathogens while sparing beneficial microbiota . This precision approach could reduce collateral damage to the microbiome associated with broad-spectrum antibiotics.

The development of uppP inhibitors as antibacterial agents would follow a pipeline including:

  • In silico screening and rational design based on structural insights

  • Biochemical validation of candidate inhibitors using purified recombinant uppP

  • Cell-based assays to confirm bacterial growth inhibition and determine minimal inhibitory concentrations

  • Medicinal chemistry optimization for improved potency, selectivity, and pharmacokinetic properties

  • In vivo efficacy and toxicity studies in appropriate animal models

What potential roles does uppP play in M. petroleiphilum's ability to degrade environmental pollutants?

M. petroleiphilum PM1 is primarily known for its ability to degrade methyl tert-butyl ether (MTBE) and other environmental pollutants . While the direct relationship between uppP and biodegradation capabilities has not been extensively characterized, several mechanistic hypotheses can be formulated regarding potential connections:

  • Cell wall integrity under stress conditions: The degradation of xenobiotic compounds often generates reactive intermediates that can stress bacterial cell membranes and walls. UppP's role in maintaining peptidoglycan synthesis may be critical for preserving cell wall integrity during exposure to these stressors, indirectly supporting the bacterium's biodegradation capabilities .

  • Adaptive response to environmental pollutants: Transcriptome analysis of M. petroleiphilum under different growth conditions reveals complex regulatory networks that respond to environmental conditions . While direct evidence linking uppP regulation to pollutant exposure is limited, it's possible that cell wall remodeling, facilitated by uppP activity, forms part of the adaptive response to xenobiotic compounds.

  • Co-regulation with degradation pathways: High-density whole-genome cDNA microarray studies of M. petroleiphilum grown on different carbon sources, including MTBE, have identified numerous upregulated genes during pollutant metabolism . Investigation of potential co-regulation between uppP and key biodegradation enzymes could reveal functional relationships.

  • Evolutionary acquisition of degradation capabilities: M. petroleiphilum possesses unique metabolic capabilities, including growth on diverse carbon sources such as toluene, benzene, ethylbenzene, and phenol . The relationship between essential housekeeping functions like cell wall synthesis (involving uppP) and acquired biodegradation pathways might provide insights into the evolutionary processes that led to these specialized metabolic abilities.

Research methodologies to explore these potential connections would include:

  • Transcriptomic analysis comparing uppP expression levels under growth on different pollutants versus conventional carbon sources

  • Creation of uppP mutants with altered expression levels to assess impacts on biodegradation capabilities

  • Metabolic flux analysis to identify potential intersections between cell wall metabolism and biodegradation pathways

How can integrating computational and experimental approaches enhance our understanding of uppP function and inhibition?

The integration of computational methods with experimental techniques creates a powerful synergistic approach for investigating M. petroleiphilum uppP structure, function, and inhibition. This integrated methodology enables iterative refinement of hypotheses and accelerates discovery through the following framework:

  • Structural prediction and refinement cycle: Initial homology models or ab initio models of uppP provide starting points for understanding enzyme structure . These computational predictions generate testable hypotheses about critical residues, which can be validated through site-directed mutagenesis experiments. Experimental results then feed back to refine computational models, creating an iterative improvement cycle that progressively enhances structural accuracy .

  • Molecular dynamics for functional insights: Molecular dynamics simulations of uppP within membrane environments can reveal dynamic aspects of enzyme function that static structures cannot capture . These simulations can predict:

    • Conformational changes during catalysis

    • Substrate binding pathways through the membrane protein

    • Effects of mutations on protein dynamics and stability

    • Interactions with membrane lipids that may influence function

  • Virtual screening validated by biochemical assays: Computational docking of virtual compound libraries against uppP models can identify potential inhibitors . The most promising candidates from virtual screening can then be tested experimentally using the established phosphatase activity assays . This filtering process significantly increases the efficiency of inhibitor discovery compared to random compound screening.

  • Data-driven model refinement: Quantitative structure-activity relationship (QSAR) analysis of experimental inhibition data can identify key structural features associated with inhibitory potency. These insights then inform the refinement of computational models and guide the design of next-generation inhibitors with improved properties.

  • Systems biology integration: Computational models of bacterial cell wall biosynthesis pathways, incorporating uppP function, can predict the systems-level impact of uppP inhibition. These predictions can be tested experimentally through techniques such as metabolic profiling and cell wall analysis.

An example workflow for this integrated approach would proceed as follows:

  • Initial computational modeling and identification of potential active site residues

  • Experimental validation through site-directed mutagenesis and activity assays

  • Refinement of computational models based on experimental data

  • Virtual screening for potential inhibitors using the refined models

  • Experimental testing of top virtual hits in biochemical and cellular assays

  • Iterative optimization of inhibitor structures based on experimental feedback

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.