Recombinant Methylibium petroleiphilum UPF0060 membrane protein Mpe_A1656 (Mpe_A1656)

What is the basic structural composition of Mpe_A1656?

Mpe_A1656 is a UPF0060 family membrane protein from Methylibium petroleiphilum consisting of 112 amino acids. The full amino acid sequence is: MLDFLRVTGLFFVTAVAEIVGCYLPWLVLTQGRSAWLLVPAAASLAVFAWLLTLHPSAAGRTYAAYGGVYVVVALLWLWRVDGVVPTRWDLVGGAICLAGMAIIALQPRAAS . Structural analysis indicates it is a transmembrane protein with hydrophobic regions that likely span the bacterial membrane. When expressed recombinantly, it is typically fused to an N-terminal His-tag to facilitate purification while maintaining its native conformation .

What are the optimal storage conditions for preserving Mpe_A1656 activity?

To maintain optimal activity, Mpe_A1656 should be stored at -20°C/-80°C in aliquots to prevent repeated freeze-thaw cycles. The recommended storage buffer is a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, or alternatively, a Tris-based buffer with 50% glycerol . For working solutions, store aliquots at 4°C for no more than one week. When reconstituting lyophilized protein, briefly centrifuge the vial before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, adding glycerol to a final concentration of 5-50% for long-term storage .

What expression system is most suitable for Mpe_A1656 production?

E. coli is the preferred expression system for Mpe_A1656, as documented in multiple successful expressions . When designing an expression strategy, consider using a vector with a temperature-responsive promoter such as pL or cspA promoters, which allow tight regulation of protein expression . The cspA promoter is particularly effective for membrane proteins as it is highly responsive to low temperatures, directing the synthesis of over 13% of bacterial proteins during cold shock response . E. coli strains containing the host integration factor (HIF) are recommended when using vectors with the pL promoter to enhance expression efficiency .

How can I optimize the purification protocol for Mpe_A1656?

A methodical purification approach for His-tagged Mpe_A1656 involves the following steps:

• Cell lysis: Use gentle lysis conditions to preserve membrane protein integrity

• Initial capture: Apply lysate to Ni-NTA or similar affinity resin

• Washing: Remove non-specific binding proteins with incremental imidazole concentrations

• Elution: Use higher imidazole concentration (250-300 mM) buffer

• Quality assessment: Verify purity via SDS-PAGE (should exceed 90%)

To distinguish full-length proteins from truncated products, consider using expression vectors with fusion tags on both ends and increase the imidazole concentration during elution . For membrane proteins like Mpe_A1656, include appropriate detergents in your buffers to maintain solubility throughout the purification process .

What data table format is recommended for tracking Mpe_A1656 purification results?

For systematic documentation of purification results, implement a structured data table as follows:

This format follows established guidelines for scientific data tables, with the independent variable (purification step) in the left column and dependent variables (measurements) in subsequent columns . Include a derived quantity column (e.g., recovery percentage) to evaluate purification efficiency across different preparations.

How can I assess the membrane integration and topology of Mpe_A1656?

To determine the membrane topology of Mpe_A1656, employ a multi-technique approach:

• Computational analysis: Use hydropathy plots and transmembrane prediction algorithms to identify potential membrane-spanning regions in the sequence MLDFLRVTGLFFVTAVAEIVGCYLPWLVLTQGRSAWLLVPAAASLAVFAWLLTLHPSAAGRTYAAYGGVYVVVALLWLWRVDGVVPTRWDLVGGAICLAGMAIIALQPRAAS

• Protease accessibility assays: Treat membrane vesicles containing Mpe_A1656 with proteases to identify protected regions

• Cysteine scanning mutagenesis: Systematically replace amino acids with cysteine and probe accessibility with thiol-reactive reagents

• Fluorescence resonance energy transfer (FRET): Engineer fluorescent protein tags at putative intracellular and extracellular domains

Record results in a comprehensive table that correlates predicted transmembrane segments with experimental evidence, noting discrepancies that might indicate unique structural features of this UPF0060 family protein.

What approaches can reveal potential binding partners of Mpe_A1656?

To identify interaction partners of Mpe_A1656, implement complementary experimental strategies:

• Pull-down assays: Use His-tagged Mpe_A1656 as bait to capture interacting proteins from Methylibium petroleiphilum lysates

• Bacterial two-hybrid screening: Construct fusion proteins to detect protein-protein interactions in vivo

• Cross-linking studies: Apply membrane-permeable cross-linkers to stabilize transient interactions before isolation

• Co-immunoprecipitation: Develop antibodies against Mpe_A1656 for immunoprecipitation of protein complexes

• Proximity-dependent biotin labeling: Fuse Mpe_A1656 to a biotin ligase to identify proteins in close proximity in vivo

Document all potential interacting partners in a relational database that includes detection method, statistical significance, and biological context to prioritize candidates for validation studies.

How can I design experiments to elucidate the physiological function of Mpe_A1656?

To determine the biological role of Mpe_A1656, implement a systematic research strategy:

• Gene deletion studies: Create knockout strains of Methylibium petroleiphilum lacking the Mpe_A1656 gene and analyze phenotypic changes

• Complementation analysis: Reintroduce wild-type or mutated versions of Mpe_A1656 to knockout strains to verify functional restoration

• Transcriptomic profiling: Compare gene expression patterns between wild-type and knockout strains under various conditions

• Metabolomic analysis: Identify metabolic pathways affected by Mpe_A1656 deletion

• Stress response characterization: Test sensitivity of knockout strains to various stressors (osmotic pressure, pH changes, membrane-disrupting agents)

While limited information exists about specific pathways involving Mpe_A1656 , systematically document all phenotypic changes in knockout versus wild-type strains to generate hypotheses about its functional role in Methylibium petroleiphilum physiology.

What mutagenesis strategies are most informative for structure-function analysis of Mpe_A1656?

For comprehensive structure-function analysis, employ these targeted mutagenesis approaches:

• Alanine scanning: Systematically replace conserved residues with alanine to identify functionally critical amino acids

• Charge reversal mutations: Modify charged residues to opposite charges to probe electrostatic interactions

• Domain swapping: Exchange putative functional domains with homologous proteins to test domain-specific functions

• Truncation analysis: Create series of N- and C-terminal truncations to identify minimal functional units

• Site-directed mutagenesis of predicted active sites: Target specific residues based on structural homology to better-characterized UPF0060 family proteins

For each mutant, assess expression level, membrane localization, and functional parameters to create a comprehensive mutation-function relationship map of the protein.

How can I resolve expression problems with recombinant Mpe_A1656?

When encountering difficulties expressing Mpe_A1656, implement this systematic troubleshooting workflow:

• Codon optimization: Analyze the Mpe_A1656 sequence for rare codons in E. coli and optimize accordingly, as hydrophobic membrane proteins with rare codons often cause expression difficulties

• Promoter selection: Test different promoter systems, particularly temperature-responsive promoters like cspA that enhance expression at low temperatures (15-16°C)

• Expression strain evaluation: Compare expression levels in different E. coli strains, particularly those designed for membrane protein expression

• Fusion tag optimization: Test various fusion partners (beyond His-tag) that can enhance solubility and expression

• Induction conditions: Systematically vary temperature, inducer concentration, and induction duration

Document all optimization attempts in a structured format to identify patterns that lead to successful expression of this membrane protein.

What strategies can improve the solubility and stability of purified Mpe_A1656?

To enhance the solubility and stability of Mpe_A1656 during and after purification:

• Detergent screening: Test multiple detergent types and concentrations (non-ionic, zwitterionic, etc.) for optimal extraction and stability

• Buffer optimization: Systematically vary buffer components (salt concentration, pH, additives) to identify stabilizing conditions

• Addition of lipids or cholesterol: Include specific lipids that may enhance membrane protein stability

• Analyze aggregation propensity: Use analytical techniques (size exclusion chromatography, dynamic light scattering) to monitor aggregation state

• Stabilizing additives: Test glycerol, trehalose, arginine, or specific ion combinations known to stabilize membrane proteins

Record stability data over time under different conditions to develop an evidence-based protocol for maintaining Mpe_A1656 in its native conformation during experimental procedures.