Recombinant Methylibium petroleiphilum UPF0761 membrane protein Mpe_A1422 (Mpe_A1422)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Mpe_A1422; UPF0761 membrane protein Mpe_A1422
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-416
Protein Length
full length protein
Species
Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Target Names
Mpe_A1422
Target Protein Sequence
MAGIISSMTVPDLLKAGWRERIALLAETLQTWPWLDTLKTLRQRFREDRLGLTASSLTFT TTIALVPLATVTLAIFSAFPMFGQFQGALEKYFIQSLVPDGIAKPVLGALTQFAGKAHRL GTVGLVVLVLTALALMLTIDRTLNAIWRVRKPRPIAQRVLVYWAAATLGPLLLGVSLTLT SYAISASRGVVGAMPGSLSVLLNALEFGLLAAAMAGLFHYVPNTEVRWRHALAGGLFVSA GFELAKKGLAWYLAQVPTYSTIYGAFATVPIFLIWLYLGWVIVLLGAVIAAYAPSLSMHI VRQPNTPGYRFQAAVQLLRELAAARARGERGLGLVGLASTLRTDPLQIEPSLERLVELDW VGRLDEAGEKRYVLLCDPNTTPAQPLLAALLLDPSPGLRGFWQRARFGEMTLQELI
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Methylibium petroleiphilum UPF0761 membrane protein Mpe_A1422?

Methylibium petroleiphilum UPF0761 membrane protein Mpe_A1422 is a full-length (416 amino acid) membrane-associated protein encoded in the genome of Methylibium petroleiphilum, a bacterium notable for its ability to degrade the gasoline additive methyl tert-butyl ether (MTBE). This protein belongs to the UPF0761 family of membrane proteins with currently uncharacterized function. The protein is identified in genomic databases with the UniProt ID A2SFP5 and is encoded by the gene Mpe_A1422 . Methylibium petroleiphilum strain PM1 is a significant member of subsurface microbial communities in gasoline-contaminated aquifers, and understanding its membrane proteins may provide insights into its remarkable degradative capabilities .

What are the key characteristics of Methylibium petroleiphilum as a bacterial species?

Methylibium petroleiphilum is a Gram-negative, rod-shaped, motile, non-pigmented, facultative aerobic bacterium that grows optimally at pH 6.5 and 30°C. It belongs to the class Betaproteobacteria within the Sphaerotilus-Leptothrix group. Taxonomically significant features include:

  • Phylogenetic classification: 16S rRNA gene sequence identity to related genera ranges from 93-96%

  • Key chemotaxonomic markers: Q-8 as the major quinone, C16:1ω7c and C16:0 as major fatty acids

  • Genomic composition: DNA G+C content of 69 mol%

  • Metabolic versatility: Functions as a facultative methylotroph that can use methanol as a sole carbon source

  • Degradative capacity: Can grow heterotrophically on ethanol, toluene, benzene, ethylbenzene, and dihydroxybenzoates

Its genome consists of a circular chromosome (4,044,225 bp) and a megaplasmid (pPM1, 599,444 bp) carrying 4,477 putative coding sequences (CDSs) .

What are the recommended approaches for recombinant expression of Mpe_A1422?

For successful recombinant expression of Mpe_A1422, researchers should consider the following methodological approach:

Expression System Selection:

  • E. coli-based expression: The commercially available recombinant Mpe_A1422 is expressed in E. coli with an N-terminal His-tag . This system offers high yields and established purification protocols.

  • Alternative expression hosts: For functional studies, consider Methylibium-related hosts or other Gram-negative systems that may provide more native-like membrane environments.

Expression Vector Design:

  • Include appropriate fusion tags (His, GST, MBP) to facilitate purification

  • Consider fusion partners that enhance membrane protein solubility

  • Include protease cleavage sites to remove tags if needed for functional studies

Expression Conditions:

  • Lower induction temperatures (16-20°C) often improve membrane protein folding

  • Use of specialized E. coli strains (C41, C43) developed for membrane protein expression

  • IPTG concentration optimization (typically 0.1-0.5 mM)

  • Extended expression times (16-24 hours) at reduced temperatures

Table 2.1: Optimization Parameters for Mpe_A1422 Expression

ParameterRecommended RangeNotes
Host strainBL21(DE3), C41(DE3), C43(DE3)C41/C43 strains specifically designed for membrane proteins
Induction temperature16-25°CLower temperatures reduce inclusion body formation
IPTG concentration0.1-0.5 mMStart with lower concentrations
MediaLB, TB, 2×YT, M9Rich media (TB, 2×YT) often yield higher biomass
Expression time4-24 hoursMonitor expression time course to determine optimal harvest time
OD600 at induction0.6-0.8Mid-log phase typically optimal

For particularly challenging expression scenarios, consider membrane-mimetic systems or cell-free expression methods that have shown success with recalcitrant membrane proteins .

How should researchers approach purification and storage of Mpe_A1422?

Purification of membrane proteins like Mpe_A1422 requires careful consideration of detergent selection and buffer conditions to maintain native conformation:

Membrane Extraction:

  • Harvest cells and resuspend in lysis buffer containing protease inhibitors

  • Disrupt cells via sonication, French press, or homogenization

  • Isolate membrane fraction through differential centrifugation

  • Solubilize membranes using appropriate detergents (start with n-dodecyl-β-D-maltoside, DDM, or n-octyl-β-D-glucopyranoside, OG)

Purification Strategy:

  • Affinity Chromatography: Using His-tag affinity with Ni-NTA or TALON resins

  • Size Exclusion Chromatography: To remove aggregates and achieve higher purity

  • Ion Exchange Chromatography: Optional step for removing contaminants

Storage Recommendations:

  • Store purified protein in buffer containing 6% trehalose at pH 8.0 to enhance stability

  • Aliquot protein and store at -20°C/-80°C to avoid freeze-thaw cycles

  • Add 5-50% glycerol as a cryoprotectant (recommended final concentration of 50%)

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL concentration

Table 2.2: Detergent Screening for Mpe_A1422 Solubilization

DetergentCritical Micelle ConcentrationSuitable forNotes
DDM0.17 mMExtraction & PurificationMild detergent, preserves function
OG20-25 mMExtraction & CrystallizationEasily removable for crystallization
LDAO1-2 mMExtractionEffective but can be harsh
Digitonin0.5 mMFunctional studiesVery mild, good for complex integrity
SDS7-10 mMDenaturing extractionUse only for analytical purposes

For long-term storage, avoid repeated freeze-thaw cycles, which can lead to protein denaturation and aggregation. Working aliquots can be stored at 4°C for up to one week .

What methodologies are recommended for functional characterization of Mpe_A1422?

Functional characterization of Mpe_A1422 requires a multidisciplinary approach combining biochemical, biophysical, and genetic techniques:

Biochemical Characterization:

  • Ligand binding assays: Using fluorescence-based or isothermal titration calorimetry (ITC) to identify potential substrates or binding partners

  • Transport assays: If Mpe_A1422 functions as a transporter, liposome reconstitution followed by substrate uptake measurements

  • Enzymatic activity testing: Assess potential catalytic activities based on structural predictions and homology

Structural Analysis:

  • Circular dichroism (CD): To assess secondary structure composition and thermal stability

  • Cryo-electron microscopy: For medium to high-resolution structural determination

  • X-ray crystallography: Requires successful crystallization of the purified protein

  • NMR spectroscopy: For dynamics studies of specific domains or the entire protein in detergent micelles

Genetic Approaches:

  • Gene knockout/complementation: Assess phenotypic changes in MTBE degradation capability

  • Site-directed mutagenesis: Target conserved residues to identify functional domains

  • Suppressor mutation analysis: Identify genetic interactions with other components

Computational Methods:

  • Homology modeling: Predict structure based on related proteins with known structures

  • Molecular dynamics simulations: Examine potential conformational changes and substrate interactions

  • Evolutionary analysis: Identify conserved domains across related species

These methodologies should be applied in a stepwise manner, with initial computational predictions guiding targeted biochemical and structural experiments .

How might Mpe_A1422 contribute to MTBE degradation pathways?

While direct evidence linking Mpe_A1422 to MTBE degradation is not explicitly stated in the available literature, several methodological approaches can be employed to investigate this potential connection:

Genomic Context Analysis:
The genome of Methylibium petroleiphilum contains a megaplasmid (pPM1) that apparently carries genetic information responsible for the organism's ability to degrade MTBE . Researchers should examine whether Mpe_A1422 is located on this plasmid or is chromosomally encoded, as this may provide initial insights into its potential role in MTBE metabolism.

Comparative Expression Studies:

  • Compare Mpe_A1422 expression levels in cells grown with and without MTBE as the sole carbon source

  • Perform time-course expression analysis during MTBE degradation

  • Use RT-qPCR and proteomics to quantify changes in gene and protein expression

Functional Investigation:

  • Gene deletion/complementation: Create knockout mutants and assess changes in MTBE degradation capacity

  • Protein localization: Determine if Mpe_A1422 is associated with other proteins known to be involved in MTBE degradation

  • Transport assays: Test if Mpe_A1422 can transport MTBE or its metabolites across membranes

Metabolic Pathway Integration:
MTBE degradation in Methylibium petroleiphilum proceeds through several steps, potentially including:

  • Initial oxidation of MTBE to tert-butyl alcohol (TBA)

  • Further oxidation to 2-methyl-2-hydroxy-1-propanol

  • Conversion to 2-hydroxyisobutyrate

  • Entry into central metabolism

As a membrane protein, Mpe_A1422 might function in:

  • MTBE uptake into the cell

  • Export of metabolic intermediates

  • Sensing of environmental MTBE to regulate degradation pathways

  • Membrane anchoring of degradative enzyme complexes

What approaches are recommended for studying protein-protein interactions involving Mpe_A1422?

Investigating protein-protein interactions (PPIs) involving membrane proteins like Mpe_A1422 requires specialized techniques that account for the hydrophobic nature of these proteins:

In vivo Approaches:

  • Bacterial two-hybrid systems: Modified for membrane protein analysis

  • Split-GFP complementation: Particularly useful for visualizing interactions in their native membrane environment

  • FRET/BRET: For detecting proximity-based interactions in living cells

  • Chemical crosslinking followed by mass spectrometry: To capture transient interactions

In vitro Methods:

  • Co-immunoprecipitation: Using antibodies against Mpe_A1422 or potential interacting partners

  • Pull-down assays: Utilizing His-tagged Mpe_A1422 as bait

  • Surface plasmon resonance (SPR): For quantitative binding kinetics

  • Isothermal titration calorimetry (ITC): For thermodynamic characterization of interactions

Table 3.3: Methods for Studying Membrane Protein Interactions

MethodAdvantagesLimitationsSuitable for
Bacterial two-hybridIn vivo detectionLimited to binary interactionsInitial screening
Split-GFPVisualizes in native contextRequires genetic modificationConfirming interactions
Co-IPCan detect native complexesRequires specific antibodiesComplex identification
Crosslinking-MSCaptures transient interactionsComplex data analysisInteraction interface mapping
Pull-downRelatively simpleMay detect non-specific bindingBinary interaction verification
SPRQuantitative kineticsRequires purified proteinsDetailed binding analysis

When designing PPI experiments with Mpe_A1422, consider:

  • Using appropriate detergents or nanodiscs to maintain protein structure

  • Including proper negative controls to account for hydrophobic interactions

  • Validating interactions through multiple independent methods

  • Considering the potential impact of fusion tags on interaction properties

How should researchers interpret discrepancies in experimental data regarding Mpe_A1422?

When encountering conflicting or unexpected results in Mpe_A1422 research, employ a systematic approach to data interpretation and troubleshooting:

Common Sources of Discrepancies:

  • Protein conformational heterogeneity: Membrane proteins often exist in multiple conformational states

  • Detergent effects: Different detergents can significantly alter protein behavior

  • Expression system artifacts: Non-native expression systems may lack proper folding machinery

  • Post-translational modifications: Varying degrees of modification between preparations

  • Experimental conditions: Small variations in pH, temperature, or ionic strength

Methodological Resolution Approach:

  • Verify protein identity and integrity:

    • Confirm protein sequence through mass spectrometry

    • Assess homogeneity through size-exclusion chromatography

    • Check for degradation using SDS-PAGE and Western blotting

  • Evaluate experimental conditions:

    • Systematically vary buffer components, pH, and temperature

    • Test multiple detergents or membrane mimetics

    • Consider time-dependent effects on protein stability

  • Apply orthogonal techniques:

    • If functional assays yield conflicting results, apply structural methods to check conformational state

    • When structural data is inconsistent, validate with functional assays

    • Use computational modeling to rationalize experimental observations

  • Control for contextual factors:

    • Compare results from different expression systems

    • Assess the impact of purification tags on protein behavior

    • Consider the influence of lipid environment on membrane protein function

What challenges might researchers encounter when working with recombinant Mpe_A1422 and how can they be addressed?

Working with membrane proteins like Mpe_A1422 presents several technical challenges that require specific mitigation strategies:

Table 4.2: Common Challenges and Solutions in Mpe_A1422 Research

ChallengeManifestationMitigation Strategy
Low expression yieldsInsufficient protein for experimentsOptimize codon usage, use specialized strains (C41/C43), lower induction temperature, test fusion partners
Protein aggregationFormation of inclusion bodiesExpress at lower temperatures (16-20°C), use mild detergents, add stabilizing agents like glycerol or trehalose
Poor solubilizationInefficient extraction from membranesScreen multiple detergents, optimize detergent:protein ratio, try different solubilization temperatures
Loss of functionInactive protein after purificationReconstitute into liposomes or nanodiscs, preserve native lipids during purification, add cofactors
Structural heterogeneityMultiple peaks in size exclusionOptimize buffer conditions, screen additives, consider protein stabilizing mutations
DegradationMultiple bands on SDS-PAGEAdd protease inhibitors, reduce purification time, optimize storage conditions

Case-Specific Recommendations for Mpe_A1422:

  • Store as lyophilized powder for long-term stability

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol as a cryoprotectant

  • Store working aliquots at 4°C for up to one week

  • For longer storage, maintain at -20°C/-80°C in Tris/PBS-based buffer with 6% trehalose at pH 8.0

When troubleshooting expression and purification issues, a systematic approach is essential. Document all conditions tested and results obtained to identify patterns that may reveal the underlying causes of problems .

How does comparative genomic analysis inform our understanding of Mpe_A1422 function?

Comparative genomic approaches provide valuable insights into potential functions of Mpe_A1422 by analyzing its conservation, genomic context, and evolutionary relationships:

Methodological Framework for Comparative Analysis:

  • Sequence-Based Comparisons:

    • Identify homologs across bacterial species using BLASTP and HMM-based searches

    • Construct phylogenetic trees to visualize evolutionary relationships

    • Calculate sequence conservation metrics to identify functionally important residues

  • Genomic Context Analysis:

    • Examine gene neighborhood conservation (synteny analysis)

    • Identify co-occurring genes that may function in the same pathway

    • Analyze operon structures across related species

  • Comparative Expression Analysis:

    • Compare expression patterns of homologs under similar conditions

    • Identify shared regulatory elements across species

The genome of Methylibium petroleiphilum strain PM1 consists of a circular chromosome (4,044,225 bp) and a megaplasmid (pPM1, 599,444 bp). The genome carries 4,477 putative coding sequences (CDSs), with 964 being unique to PM1. The pPM1 plasmid contains a disproportionately large number (382) of these unique genes .

Comparative genome hybridization with two PM1-like MTBE-degrading environmental isolates (with ~99% identical 16S rRNA gene sequences) showed that while the plasmid was highly conserved (ca. 99% identical), the chromosomes were quite diverse . This suggests that genes located on the plasmid, potentially including Mpe_A1422 if it is plasmid-encoded, may have specific functions related to MTBE degradation or other specialized metabolic capabilities.

Researchers should investigate whether Mpe_A1422 is present in other MTBE-degrading bacteria and analyze patterns of gene gain/loss and horizontal gene transfer to understand its evolutionary history and potential functional importance .

What bioinformatic tools are recommended for predicting membrane topology of Mpe_A1422?

Accurate prediction of membrane protein topology is crucial for functional characterization and experimental design. For Mpe_A1422, a multi-tool consensus approach is recommended:

Primary Sequence-Based Prediction Tools:

  • TMHMM/HMMTOP: Hidden Markov Model-based predictions of transmembrane helices

  • Phobius: Combined transmembrane topology and signal peptide predictor

  • TOPCONS: Consensus prediction from multiple algorithms

  • MEMSAT: Uses neural networks for topology prediction

  • OCTOPUS: Identifies membrane protein topology using hidden Markov models

Structure-Based Approaches:

  • AlphaFold2/RoseTTAFold: For generating structural models that can inform topology

  • 3D-JIGSAW: Homology modeling if structural homologs exist

  • I-TASSER: Threading-based approach for membrane protein modeling

Integrated Analysis Pipeline:

  • Run multiple prediction algorithms independently

  • Generate consensus prediction

  • Validate using hydrophobicity plots

  • Refine using evolutionary conservation data

  • Incorporate experimental constraints if available

Table 5.2: Recommended Topology Prediction Tools for Mpe_A1422

ToolAlgorithm BasisStrengthsWeb Resource
TMHMMHidden Markov ModelHigh accuracy for alpha-helical TM proteinshttps://services.healthtech.dtu.dk/service.php?TMHMM-2.0
PhobiusHMM with signal peptide integrationDistinguishes signal peptides from TM heliceshttps://phobius.sbc.su.se/
TOPCONSConsensus methodCombines results from multiple predictorshttps://topcons.cbr.su.se/
MEMSAT-SVMSupport Vector MachineGood at detecting re-entrant heliceshttp://bioinf.cs.ucl.ac.uk/psipred/
AlphaFold2Deep learningProvides full structural modelhttps://alphafold.ebi.ac.uk/

For Mpe_A1422, preliminary analysis suggests multiple transmembrane domains consistent with its annotation as a membrane protein. Researchers should combine these computational predictions with experimental validation approaches such as cysteine scanning mutagenesis, reporter fusion assays, or protease accessibility mapping to refine topology models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.