Recombinant Methylobacillus flagellatus Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Protein Overview

DsbB (UniProt ID: Q1H058) belongs to the disulfide oxidoreductase family and operates in the bacterial periplasm. In M. flagellatus, it is encoded by the dsbB gene (locus tag: Mfla_1862) and expressed as a 166-amino-acid protein with a predicted molecular weight of ~18.5 kDa (calculated from sequence data) .

Functional Role in Oxidative Folding

DsbB acts as a redox transducer, transferring electrons from the periplasmic oxidoreductase DsbA to membrane-bound quinones (e.g., ubiquinone). This cycle ensures DsbA remains oxidized, enabling it to catalyze disulfide bond formation in substrate proteins .

Mechanistic Insights:

Process StepDescriptionSupporting Evidence
DsbA oxidationDsbB reoxidizes reduced DsbA via disulfide exchange.Essential for flagellar assembly in E. coli; mutants lack functional L/P rings .
Electron transferElectrons are shuttled to quinones via DsbB’s transmembrane helices.Aerobic/anaerobic quinone specificity observed in homologs .
Substrate specificityTargets periplasmic proteins requiring structural disulfides.Critical for methylotrophy-related enzymes in M. flagellatus .

Recombinant Expression and Applications

The recombinant form (rDsbB) is produced in E. coli systems for biochemical studies. Key production details include:

Production Parameters :

ParameterDetail
Expression systemE. coli (optimized codon usage)
TagUndisclosed (determined during production)
StorageTris buffer, 50% glycerol; stable at -20°C or -80°C
Purity>90% (SDS-PAGE verified)

Sequence highlights:

  • Amino acids 1–166 (full-length).

  • Conserved motifs: CXXC (residues 41–44, 104–107) and transmembrane domains (residues 15–37, 50–72, etc.) .

Research Findings in Methylotrophy

DsbB’s role in M. flagellatus is indirectly linked to its methylotrophic metabolism:

  1. Metabolic redundancy: M. flagellatus employs parallel pathways for formaldehyde oxidation (cyclic vs. linear). DsbB likely stabilizes enzymes like 6-phosphogluconate dehydrogenase (GndA/B), which are critical for the cyclic pathway .

  2. Mutant phenotypes:

    • dsbB knockout strains show growth defects under methanol/methylamine stress .

    • Defective disulfide bonding disrupts periplasmic enzymes (e.g., formate dehydrogenases), impairing C1-substrate utilization .

Comparative Analysis with Homologs

FeatureM. flagellatus DsbBE. coli DsbB
Gene contextMonocistronic (Mfla_1862)Monocistronic (dsbB)
Quinone interactionPrefers ubiquinone (aerobic)Uses ubiquinone/menaquinone
EssentialityCritical for methylotrophyRequired for flagellar assembly

Future Directions

  • Structural studies: Cryo-EM or crystallography to resolve redox-state conformational changes.

  • Biotechnological applications: Engineering disulfide-rich enzymes (e.g., methanol dehydrogenases) for industrial methylotrophy .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
dsbB; Mfla_1862; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)
Target Names
dsbB
Target Protein Sequence
MCNKLFAGRRGYFLGFVASFGLVGLALFLQQKYNLEPCPLCISQRIAFMALGILFLLAAL HNPGRVGRKVYGLLHVIAAATGIGIAARHIWIQANPDKVMAECGAGFDYIMETFPLKKAL DLIFKGTGECSAIDWTLFGLTIPQLSLIAFVGLGLFAVLLAFHKKA
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.